KEGG   Xenopus laevis (African clawed frog): 108712508Help
Entry
108712508         CDS       T01010                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00562  Inositol phosphate metabolism
xla01100  Metabolic pathways
xla04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108712508
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108712508
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     108712508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 108712508
NCBI-ProteinID: XP_018110195
UniProt: A0A1L8GQ56
Position
3S
AA seq 1635 aa AA seqDB search
MDHSHQNDISQPHDNSGVQLPAFSFPNTQYDQAYPAGTFVPNIQTYPGLPSQMALGFDSF
LPPTNNVAPSIVPYQFQSTNWLEEHLQSFPAQTSPDLQGPSEQDAEQPLPGVTGIGFEHF
WGLESDEPTTHYHSINIQFNGNRQRDGVFSAGEDFTQVSRRHTIHIAPDSNNFFFQTQTT
NTNEITQRSRSLYGYSAHQSLDLEEPPTASHHSWKSEKQEWRIKLLDSSENSNKDFGAFC
DAVKTIRREYSASDPVSNSGRVWSVAVRFPLGVSVESDLNITVYGDCLPHPLNYSEKDCV
HVQDFISRMIQHNYSVMQHPNNPAPQYPDSPAPQYPNSHAPQYSNSHAPQYPNSPAPQYS
NSHAPQYPNSPAPQYPNSPAPQYPNSHAPQYPNSPAPQYSNSHAPQYPNSHAPQYSNSHA
PQYPNSHAPQYPNSHAPQYPNSPAPQYYNSPAPQYSNSPAPQYPNSPAPQHPNSHVSQYS
NSPAPLHPNYPVLQQCQYPSLQGIYPPLQPQVSLSHPQDPPGQHLYPSLHSVSQQEYRLA
QNDHPPAQPTYHSAPQQLYPSPPYCASPSQYPPAPPQGYLVSICGFDEFLQNDFTFRCHT
KLQRLTSVQLRLHLRPQPLLCRTKEEDQSDWQLDLSEHGQYWTQMKSRLTNAVSHYGDQA
LSFLNNKVYVTHVLEAVREICYLLRGVETKELSTALNALRHSQYLMANQGGTSQVSQQSV
VLGVSRALAHLISIYSSSFNADFLVEIPRSPRCRTESPDSHLSFHLYSAHNLPDNWVNRI
STFSLSCSVIYAGRKLCPEMKSRGAQATHSMFSLVTWDEVITFPLPVCVLPYESILVLRL
SGLDNGSNKTANLAWSCLPLYSHGRFARGAMLLNMISHAEPPPVITPGAIDKTLPTLVTV
QVELPEINQTFSQPAPEQIAGNVPSEDPSGFLEILVHRNSVLLLSEADKQYLWNYRSCCK
KPRNILPLVLGSAPGWDPSIISAMYRVLGDWTFSHPLEGLGLLNSSFSDQRIRETSCLEI
GKLPNDELLDFLPQLVQAVKFEWSLDSPLVKLLLHRSLQSIQVAHRLFWLLTDAHKESHY
RGLYSKVLAALQSCAGNALNGEFCTQKRLISILQGIAEKVKTSPDTKRQETLQSNLHQLQ
RFFQEAQLCRLPLDPAVRVRGIDPNACSFFKSNASPLKISFLNADPLGKKINVIFKLGDD
LRQDMLVLQIIEVIDRIWLHEGLDLRMITYKCLSTGLNQGLVQMVPDATTLAKIHEHSGI
LGPLKDKSIKKWFKSKQPLQHNYEKAKENFLFSCAGWCVVTFILGVCDRHNDNIMVTNTG
HMFHIDFGKFLGHAQKFGSIKRDRAPFIFTSEMEYFITDGGKNLDRARDFVELCCQAYNI
LRKHSHLLINMLELMLQGGLPELCGVEDLRYLQNNLRPQDSEPEATSYFTRKISESLQCF
PVKLNNLIHILANTSLSDMAKSVSQIDLMDPAGGNPKNLIKRAAIASIRKINKKSEKVLN
YLGAEGRTGAASSSGDTDVRPAVQLHVSYKNQTLSVLIKHLRNIHLPDGSSPCTEIEVLL
LPDPQQTSLRRVKSTGKSALIYNEIVRYSLLPLVAGYVIRLVVRSKGQLIAAVNVPVDHM
QFDSDVWYPMGLSLA
NT seq 4908 nt NT seq  +upstreamnt  +downstreamnt
atggatcacagtcaccaaaatgacatctctcaaccacatgacaactcaggtgtccagtta
cctgcattttccttccccaacacccagtatgatcaagcgtatccagctggaacttttgtg
cccaatatccagacctatccaggtctccctagtcagatggctcttggatttgactcattt
ttgcctcccacaaacaatgtggccccttctatagttccctatcagttccaatcaaccaac
tggcttgaagaacatctacagagctttccagctcaaacctcccctgatttgcaaggacct
tctgagcaagatgcagagcagcccctgcctggagtcacaggaattgggtttgagcatttc
tggggattggagtctgatgaacccactactcattatcattccatcaatatccagtttaat
ggaaacagacaaagagatggagtattttctgcaggagaagactttacccaagtctcaagg
agacacactatacacattgcaccagactcaaataactttttttttcaaacacaaacaaca
aacaccaatgaaatcacccagaggtcacggtcattatatggatactcagctcatcagtct
ttggatttggaggaaccacccactgcatctcatcattcctggaaatctgagaaacaggaa
tggcggatcaagcttttagactcctcagagaacagtaacaaggactttggtgcattttgt
gatgcagtgaaaactatccggagggaatattctgcgtctgaccccgtctccaattcgggg
agagtgtggagcgttgcagtgaggttccccttgggggtcagtgtagagtcagacctgaat
atcactgtgtatggagactgtctgcctcatcccctcaactactctgagaaagattgtgtt
catgttcaggatttcatttcaagaatgattcagcacaactattctgtgatgcagcacccc
aacaatcctgcacctcagtaccccgactctcctgcacctcagtaccccaactctcatgca
cctcaatactccaactctcatgcacctcagtaccccaactctcctgcacctcaatactcc
aactctcatgcacctcagtaccccaactctcctgcacctcagtaccccaattctcctgca
cctcagtaccccaactctcatgcacctcagtaccccaactctcctgcacctcaatactcc
aactctcatgcacctcagtaccccaactctcatgcacctcagtactccaactctcatgca
cctcagtaccccaactctcatgcacctcagtaccccaactctcatgcacctcagtatccc
aactctcctgcacctcaatactacaactctcctgcacctcaatactccaactctcctgca
cctcagtaccccaactctcctgcacctcagcaccccaactctcatgtatctcagtactcc
aactctcctgcacccctgcaccctaactatcctgtgctacagcaatgccagtacccttcc
ctgcaaggtatctacccacccctacagccccaagtatcactatcccatccacaagacccc
ccagggcagcatctgtacccctctttacattcagtctcccagcaggaatatagactggca
cagaatgatcaccccccagctcagcccacctaccactctgcaccccagcagctttaccca
tcaccaccatattgtgccagcccctcccaatacccacctgcacccccacagggctattta
gtgagtatctgcggatttgacgagttcttacaaaatgacttcactttccgctgccacacg
aagctacagagactgacgtcagttcagctgcgacttcacctgagaccccaacccctcctg
tgccgcacgaaggaagaggatcaaagtgattggcagttggatctgtcggaacatggacag
tactggacccaaatgaagagcagacttaccaatgccgtgtcccactatggggatcaagcc
ctgtcctttctgaataacaaggtgtatgtgacccacgtgttggaagctgtgagggaaatt
tgttatttactccgtggagttgaaaccaaagagctcagcacagccctcaatgctttgcgc
cactcacagtatctcatggcaaatcaaggaggcacctcccaagtttcccagcagagcgtg
gtgctgggggtatcgagggccctcgctcatctcatcagtatctacagcagcagctttaat
gcggattttctagtggaaatacccagaagcccccgctgcagaactgaaagccccgattcc
catctctccttccatctgtattcggctcacaacctccccgacaactgggtgaatagaatc
agcactttttctctgagctgttcggtgatttacgctggaaggaaactttgccctgaaatg
aaatctcggggggctcaagcaacgcattcgatgttctccttggtgacgtgggatgaggta
atcacatttccacttcccgtctgtgtcctgccctatgaatccattctggttctgagactc
agtggcctcgacaatggctccaataaaactgccaacttggcctggtcctgcctccccctc
tactctcacgggagatttgccaggggggcgatgctgctgaacatgatttctcacgccgag
ccccctcctgttattaccccgggggcaattgataagacgttgccgacacttgttacagtg
caggttgaattaccagaaataaaccagactttcagccaaccggcgcccgagcaaattgcc
ggcaatgttccgtcagaagatccttccggattcctggagatattggtgcatcggaattct
gtcctcctactctcagaagctgacaagcaatatctatggaactatcggtcctgctgtaag
aagcccaggaacattctccccctggtgttgggaagtgcccctggatgggaccccagcatt
atttccgctatgtacagagttctgggggactggaccttctctcaccccttggagggtctg
ggcctgttaaattcaagcttctccgaccaaaggatccgtgaaacctcatgtctagaaatc
gggaaattgcccaatgatgagttgttagactttctgccccaactcgttcaggctgtgaag
tttgaatggagtctggacagccctctggtcaagctcttgcttcatcgctcgttacagagc
atccaggttgcacacagactcttctggctgttaacagacgctcacaaggaatctcattat
cgaggtttgtacagcaaagtgctggccgctctccagtcctgcgccggcaacgctctcaat
ggcgaattctgcacccaaaagcgtctcatcagcattctgcagggcatcgcggaaaaagtg
aagacgtctccggacacaaagcgccaggagacccttcaatcaaatctgcaccaactgcaa
cggttctttcaagaagcgcaactctgtcgcctcccgctggacccggccgttagagtcaga
gggatcgaccccaatgcctgttccttctttaaatccaacgcgtcgcctctgaaaatctcc
ttcctcaacgctgacccccttggaaagaagatcaatgtgatttttaagcttggagatgac
ctccgtcaggacatgctggttctgcagattattgaggtgatcgacagaatttggctccat
gaaggtttggacctgcggatgatcacgtacaagtgcctctctactgggctaaaccaagga
ttggttcagatggtcccagacgccacgactctggccaagatccacgagcattctgggata
ctggggccactaaaggacaaatccataaagaaatggttcaagagcaagcagcctcttcag
cacaactatgaaaaggcaaaagagaacttcctattctcctgtgctggttggtgtgtcgtt
acctttatactgggggtctgtgacagacacaatgataacattatggtgaccaacacgggg
cacatgttccacattgactttggcaagttcctcggtcatgctcagaaatttggtagcatt
aaaagagaccgagctcccttcatattcacctctgagatggaatatttcatcactgatggg
gggaagaacctcgatagagcaagagactttgtggagctctgctgtcaggcctataacatt
ctccgcaaacacagccacttactgatcaacatgctggaactgatgctacagggtgggctg
ccagaactatgtggggtagaagatctgaggtacctgcagaataaccttcggccccaggac
tctgaacccgaggccaccagctattttaccaggaaaatcagtgagagtctgcagtgtttc
ccagtaaagctgaacaatctcatacatatccttgcaaacacatcactgtcagacatggcc
aagagtgtgtctcagatcgacctcatggatcctgccgggggcaaccccaaaaatctcatt
aaacgtgcagccatcgccagtatccgcaagattaataagaaaagtgagaaagttctgaat
tatctgggtgcggagggcagaaccggggcagcttcatcgtcgggggacacggatgtgaga
cctgcagttcagcttcacgtttcctacaagaaccagacactgtcggtcctcattaagcac
ctcaggaacattcatctcccagatggctcctccccttgcaccgaaattgaggttcttctg
ttaccagatccacaacaaacgtcactgagaagggtcaaatccacagggaaatctgctctg
atctataatgaaatagtgagatactcgctactaccactcgttgctggctacgttatacga
ctggtggtgagaagcaaagggcagttgattgcggcagtgaatgtcccagtggatcacatg
cagtttgatagcgacgtctggtacccgatgggcctcagtttggcatag

DBGET integrated database retrieval system