KEGG   Xenopus laevis (African clawed frog): 108712610Help
Entry
108712610         CDS       T01010                                 

Definition
(RefSeq) glutamate receptor 1
  KO
K05197  glutamate receptor 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108712610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108712610
Ion channels [BR:xla04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   108712610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3
Motif
Other DBs
NCBI-GeneID: 108712610
NCBI-ProteinID: XP_018110389
UniProt: A0A1L8GR36
Position
3S
AA seq 902 aa AA seqDB search
MLRFFAYFCTGFLGAVLGVNFPNHIQIGGLFPNQQSQEHAAFRFALSQLSEPPKLLPQID
IVNISDSFEMTYTFCSQFSKGVYSIFGFYDRKTVNMLTSFCGALHVCFITPSFPVVTSNQ
FVLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRLLFQDLDKSKDRQIVIDCESERLNAILTQVVKLEKNIIGYHYILANLGFMDIDM
QKFKEAGANVTGFQLVNYTEPMVSRIMQQWKNYDGREQPRLDWKKPKYTSALTYDGVKVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKGR
RTNYTLHVLELKHEGIRQVAHWNEDDKLIPLATDAQAGNDTIGVQNRTYIVTTIMEAPYV
MLKKNADQLEGNDRFEGYCVELAAEIAKHVGIKYKLEIVKDGKYGARDSDMKAWNGMVGE
LVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTNDQTNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIT
YGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK
GFCLIPQSTVTETVRMATLPRPSTAGGSGENGRVVSHDFPKTMQTIPCMSHSAGMSLGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttttttgcctatttctgcaccggctttctaggggcagtgcttggggtgaat
ttccccaaccatatccagataggggggcttttcccaaaccagcaatcccaggaacatgcc
gccttccgctttgctttatcccaattgtcggaaccccccaagctgctgccccagatcgat
attgtgaacatcagcgatagctttgaaatgacctacactttttgttcacagttctccaaa
ggggtttactccatatttggattttatgaccggaagacggtgaacatgttaacctctttc
tgtggtgctctacacgtctgcttcatcacccccagcttcccagtagtcacttccaaccag
tttgtcttgcagctgaggccagagctccaagatgccctcatcagtgttattgagtattat
aagtggaaaaagtttgtttatatttatgacgcagaccgaggtttgtcagtcctgcaaaag
gttctagacacagcggctgagaagaactggcaggtgacagctgtgaatattcttaccacc
accgaagagggttaccgcctactctttcaggacctagacaagagcaaagaccggcagatt
gtgatagactgcgagtcagagaggctgaatgcaatactaacccaggttgtaaagctggag
aaaaacattatcggatatcattatattctcgcaaacttgggttttatggatattgacatg
cagaagttcaaagaagcaggtgccaacgtgacaggattccagctggtgaattacacagaa
cccatggtatccagaatcatgcagcagtggaagaattatgatggacgggaacaacctcgc
ttggactggaagaaaccaaagtacacctctgccttgacttatgatggagtaaaagtaatg
gccgaagcctttcagagtttaaggaaacagaggatagacatttctcgccgtgggaatgct
ggggactgtctagcaaaccctgcagtgccatgggggcaaggaatagatatccagcgggca
ttacaacaggttcggctggaagggctatcagggaatgtccagttcaatgagaaaggccgt
cggaccaattatacactgcatgtgcttgagctgaaacatgagggaatccgtcaggttgca
cattggaatgaagatgataaacttatcccattggcaacagatgctcaagctggcaatgac
accattggggttcaaaaccggacatacattgtcaccacaatcatggaggctccctatgtt
atgctgaagaagaacgctgatcagctagaaggcaatgaccgatttgaaggctactgtgta
gagctggctgcagagatcgccaagcacgttggcatcaagtacaagctggaaattgtgaag
gatggaaagtatggagcgcgggactctgatatgaaggcttggaatggcatggtgggagag
ctggtgtatgggagagccgatttggctgttgctcccttgacaataacactagtccgtgaa
gaggttattgacttttccaaaccattcatgagcctgggaatttcaatcatgatcaagaag
cctcagaaatccaagcctggagttttttccttcctggatccactggcttatgaaatctgg
atgtgtatagtctttgcatacattggagtcagcgtggttctcttccttgtgagtcgattc
agcccatatgagtggcacaatgaggagtttgaagaaggaaaagagcagccgacaaatgat
cagactaatgaatttggcatatttaatagcctgtggttctctttaggagcatttatgcag
caaggatgtgatatatccccaaggtctctctcaggacgaattgttgggggtgtctggtgg
ttcttcactttgatcattatttcatcttacacggcaaacctagcagccttcttgacagtt
gaaaggatggtctcacctatagagagtgcggacgacttggccaagcaaactgaaataacc
tatgggacccttgattctggatctactaaagagttttttaagagatcaaaaattgctgtg
tttgaaaagatgtggacttacatgcgttccgcagaaccctccgttttcgtaaaaacaacc
gaggaagggatgaatcgagtgagaaagtcaaagggcaaatatgcttaccttttagagtcc
accatgaatgagtacattgaacaacgaaaaccctgcgataccatgaaggtgggaggtaac
ttggactccaagggatatggcattgcaactcccaaggggtcgccactgagaggtgctgta
aacctagcggtattgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaagactccggaagtaaggataagacaagtgca
ctgagtctcagtaatgttgccggtgtgttctacattctcatcggaggtctgggattggcc
atgcttgttgcccttatcgagttttgttacaaatcaaggagtgaatccaaaaagatgaag
ggtttctgtttaattccgcagtcaacagtcacagaaacagtccggatggcaactctaccc
agaccttcaacagcaggaggaagcggtgagaacgggagagtggtcagccatgacttcccc
aaaaccatgcagacgattccttgtatgagccacagtgcaggaatgtctctgggagcaact
gggttataa

DBGET integrated database retrieval system