KEGG   Xenopus laevis (African clawed frog): 108714085Help
Entry
108714085         CDS       T01010                                 

Gene name
hsd17b2.L
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 2 L homeolog
  KO
K13368  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00140  Steroid hormone biosynthesis
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108714085 (hsd17b2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     108714085 (hsd17b2.L)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     108714085 (hsd17b2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1275 Epimerase
Motif
Other DBs
NCBI-GeneID: 108714085
NCBI-ProteinID: XP_018113453
Xenbase: XB-GENE-17343396
UniProt: A0A1L8GL07
Position
4L
AA seq 386 aa AA seqDB search
MAQLDSRLLYLAVGVFFSGSALHKLMKNKVKIENASVPGLLSLLILGIFCFFILSDSFGL
TLLTLACTLYYYSIPVRNMLSAEGKSVLITGCDSGFGHALAKHLDELGVHVFAGVLDKKG
PGAEELKRVCSSHLCLIQLNITHSEEIREAYKEISSHVQDAGLWGIVHNAGVLGYVADGE
LIPFSVYKQCMDVNFLGAVQVTKIFVPLLRKAKGRLVSISSMGGHVPLKGFAAYASSKAA
LSMFSAVMRQDLSKWGVKVAVVCPSGFRTNIFGSQEQWWCQNQVILDDVMPDVKGDYGED
YIENFKGLYHTMHKFGSSDLSPVLEDVCHALLAQTPNPSYTPGRFAYLIPCLYYYSPQWI
SDRISMQSFQTQNNMLPRALRTKNKT
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcccagttggattccaggctgctttacttagctgtgggtgtcttcttcagtggatca
gcccttcacaaattaatgaagaacaaggtgaagattgaaaatgcctctgtccctggtctc
ctgtcactgctcatattggggattttctgtttcttcattttgtctgacagttttggctta
actctattaactctagcatgtaccctctattattattccatacctgtcagaaacatgtta
agcgccgaaggaaagtctgtgcttattacagggtgtgattctgggtttggacatgcacta
gctaagcacctggatgaactgggcgttcatgtctttgctggtgtgttggataagaaaggg
cctggcgctgaagaactgaaaagggtttgttcatcacacctttgcctaatccaacttaat
atcacccattcagaggagataagggaggcctacaaggaaatcagcagtcatgtgcaagat
gcaggactgtggggcattgtgcacaacgctggggtacttggttatgtggctgatggagaa
ctaattcctttcagtgtatataagcaatgcatggatgtcaattttcttggtgcggttcag
gtcacaaaaatatttgttccattgctgcggaaagccaagggaaggctagttagcatctcc
agcatgggaggacatgtcccccttaaagggtttgcagcatatgcctcatccaaggcagct
ctttcaatgttttctgctgtgatgcgacaggatctctccaaatggggtgtaaaagttgct
gttgtttgtccaagtggattccgaacaaatatttttggttctcaagaacaatggtggtgc
caaaaccaagtcattttggatgatgtcatgccagatgtgaaaggggattatggtgaagac
tatatcgaaaactttaagggcctctaccatacaatgcacaagtttggttcctctgacctc
tcacctgtcctggaagatgtgtgccatgctttactggctcaaaccccaaatccctcatat
acacctggaagatttgcatacttaatcccatgtttatactattactctcctcagtggatt
tctgataggatatcgatgcaaagtttccagacacaaaacaacatgcttcctagggcttta
aggactaaaaacaagacataa

DBGET integrated database retrieval system