KEGG   Xenopus laevis (African clawed frog): 108715019Help
Entry
108715019         CDS       T01010                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108715019
   04020 Calcium signaling pathway
    108715019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    108715019
Ion channels [BR:xla04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108715019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 108715019
NCBI-ProteinID: XP_018115362
Position
4S
AA seq 2089 aa AA seqDB search
MQRIFLDLPSLTWFECLSMMVILLNCVTLGMFQPCQDVDCSSERCQILQVFDDFIFIFFA
MEMVVKMLALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLK
AINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTI
QGDITLPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLRDRGHECCLDKEDYYYYNAIR
HEFNVSGMCVNWNQYYNVCRTSNTNPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVM
DAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHQLMQEQRALYLSSSTVAS
YAEPGDCYEEIFQYVCHILRKAKRRTIGLYTSLQNRRQSRHELTNNKLGINGKEQHHMWI
CQKHGQLDYAPHAIVQPIAMTLTSDLSNCPQCTKTKWEDGRKLSAPNSTRSSRDGAHRQT
SESENESRSDGSTSDLDKEEEEDSDEGFCKGLFGEVRVKLRGIVDSKYFNRGIMIAILVN
TISMGIEHHEQPEELTNILEISNIVFTSMFALEMMLKLSAFGLFDYLRNPYNIFDGIIVI
ISVWEIIGQNDGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCMLLMLFI
FIFSILGMHIFGCKFSLKTDSGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMAS
TSPWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEERSSSNMEECDKYRE
VESPSDPKLCSVPMTPNGHLENSPVPTQQIPATIMNTSRNSLQRDQVLVTVGCRKSSVMS
LGRTSYDQRPQMGPRPSHWGRSGAWGSRRSSWNSLGRRHSIKPRTFTTEHESLLSHGEEQ
RERSHSRRSSSLKHSRAMSLDNKGSSDNPGDTATHPNHRGSCKGTSMSEEHRDSTGKTPP
IMTEVFPKMNNRKDKEEEEEEIDYSLCFRIRKMIEVYRPDWCALREDWSIFLFSPQNRFR
IMCQTIIAHKLFDYVVLAFIFLNCITIALERPQIEHKSTERIFLSISNYIFTAIFVAEMT
LKVVSLGLYFGDQAYLKSSWNILDGFLVFVSLVDIVVSVASAGGAKILGVLRVLRLLRTL
RPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFFYCLGVDV
RNVTNKSDCEAANYKWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPV
TNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQNQEAEEARRREEKRLRRLEKK
RRKAQRLPYYATYCPARLLIHSMCTSHYLDIFITIIICLNVITMSLEHYSQPRSLEIALK
YCNYMFTTVFVLEAVLKLVAFGFRRFFKDRWNQLDLAIVLLSVMGIILEEIEINAALPIN
PTIIRIMRVLRITRVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVEL
FGKLVCNADHPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRECTNDDRSCLS
SLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAELDAEIEMELAHGLCS
QTSPVSGLDNGGRGGRPATESHRSLRCFSPAQENLWLDSVSLIIKDSFEGELTIIDNLSG
SVFHHYSSPAICEKCNHDKQEVQLAEMEAFSLTSDKSSSVLTDELSSEDQGVTSQLKEMK
DGQDSPDSLGMFGENIFPLASIPGSPTAERFICEFEKVSLTPAESWDSWLKEESDPVSPS
PLCTDTMSPLLPVPSEFFHPGISAPETDREIPNTIDNDPKRPSQESWATLRSPGINCSLL
RQAAESNSSMESGSATSEDSLQTTLEDSLNLSDSPQCTLDLPDLRATPASHHTPLPITSL
SMIQRRGNRPSFALQNVRRHQRSHSSGGSTSPGCTLHDSMDPSDEEGAGGSLRGANEPSE
TFSSLSLTSLFSPTPSLAPPGGTIKKCSSVNSLSVAPSRVRGAKQFYTVDQQGFLSMPSW
VMDFYQTSSPSENQENSSSTEKLPTMEKGLPPSSVSGNADFGNNSRRNR
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaattttccttgaccttccttctcttacttggttcgagtgtcttagcatgatg
gtaattctcctgaactgtgtaaccctcggaatgttccagccttgtcaagatgtcgactgc
tcatcagagcgatgccaaattcttcaagtcttcgatgactttatattcatcttctttgca
atggagatggtggtgaaaatgttggccttggggatctttgggaagaagtgttaccttgga
gatacgtggaatagactggacttctttatagtcatggctgggatggtggaatattctctt
gatcttcagaacattaacctatcagccattcgcactgtgcgtgttctaagacccctaaaa
gccatcaaccgagttcccagtatgcggatcctggtgaatttgctgctggacacattgcct
atgctggggaatgtacttctgctttgtttttttgtcttctttattttcgggatcattggg
gtgcagctttgggctggattgctgcgaaaccgctgctttttggaagaaaacttcactata
caaggggacataaccttaccaccttattaccagccggaagaagatgatgaaatgccattt
atttgttctttgtctggtgacaatggaatcatggggtgtcatgaaatccccccactaaga
gaccgaggtcatgagtgctgcttggacaaagaggactattattattataacgctatccgt
cacgaatttaatgtcagtggcatgtgtgttaattggaaccaatactataacgtctgccgt
actagcaacaccaatcctcacaagggcgccatcaattttgataacattggctatgcctgg
attgtcatattccaggttatcactctggaaggctgggttgagataatgtactatgtcatg
gatgcccactccttttacaacttcatctatttcattcttcttattatagtaggatcattt
ttcatgatcaatttatgcctggttgttattgctactcaattctcagagaccaaacagagg
gagcaccaactgatgcaggagcagagggctctctatttatcctctagtactgtagccagt
tacgctgagcctggagactgctatgaggagatctttcagtatgtgtgccatatcctgcgg
aaggccaagcgccgtacaataggcctctacaccagccttcagaaccgacggcaaagccgc
catgagctcaccaataataaacttgggatcaatggcaaggaacagcatcatatgtggata
tgtcagaaacatggccagctggattatgctcctcatgctattgtgcagcctatcgcaatg
accctaacatctgacctctccaattgccctcaatgtaccaaaaccaaatgggaggatggc
cgtaagctgtcagcaccaaacagcaccagatcaagccgagatggagctcacagacagaca
agtgagagcgaaaacgagagcaggagtgatggaagtacatcagatctagacaaagaggag
gaggaggacagcgatgaaggcttttgtaaaggactgtttggtgaagtccgtgtgaagctc
agagggatagttgatagtaaatatttcaatcggggaatcatgattgccattcttgtgaac
acaatcagtatgggaatagaacatcatgagcagccagaagagctaacaaatatcctggaa
attagtaacattgtcttcactagcatgtttgctctggaaatgatgctgaaactttcagcc
tttggcctgtttgattacctgcggaacccatataatatctttgatggcatcattgtcata
atcagtgtctgggagataattgggcagaatgatggagggctgtctgtactaaggactttc
cgacttctacgagtgctgaagctggtacggtttatgcctgcattgaggcgtcagttggtg
gtattgatgaagactatggacaacgtggccacattctgcatgcttctgatgctcttcatc
ttcattttcagtatccttgggatgcatatcttcggatgtaaattcagtttaaagactgat
tccggagatactgttccagacaggaaaaactttgattctctactttgggccattgtcacg
gttttccagatccttacccaagaggattggaatgtcgtgctgtacaatggaatggccagt
acatctccatgggctgccctttactttgtagcattaatgacatttggaaattacgtttta
ttcaacttgcttgttgctatattggttgaagggtttcaagcagagggagatgccaacaga
tcttattctgatgaggaaaggagttcctctaatatggaggaatgtgataaatatcgggaa
gttgaatctccatcggatcccaaactttgttcagtacctatgactccaaatggacattta
gaaaacagccctgtcccaacccaacaaatcccagctacaataatgaatacatcaaggaat
tctcttcaaagggatcaagttcttgtaactgttggctgcagaaaaagtagtgtgatgtct
ctggggagaacttcctatgaccagaggccacaaatggggcctcgaccctcacattggggg
agaagcggtgcttgggggagccgcagatcaagttggaacagtttagggcgtcgtcacagt
ataaaaccaagaacattcacaactgagcatgaatcattgctgtcacatggagaagagcaa
agagaaagaagtcactccaggagatcatcaagtttaaagcactcaagagcaatgtctcta
gataataaaggctcttcagataatccaggtgatacagcaactcatcccaaccacagaggg
tcttgcaaaggcacatctatgtcagaagaacatcgtgactccactgggaaaacacctcct
attatgacggaagtctttcccaaaatgaataaccgaaaagataaggaggaggaagaagaa
gaaatagattacagtctgtgtttccggatccgaaaaatgattgaagtgtacagaccagac
tggtgtgcgttacgtgaggattggtctatatttcttttctccccacagaacaggttccgc
atcatgtgtcaaacaataattgcacacaagctttttgactacgtcgtccttgccttcata
ttcctcaactgcattaccatcgctttagagaggcctcagatagagcacaagagtacggaa
aggattttcctgagtatatcaaactatatcttcacagccatttttgtagctgaaatgaca
ttgaaggtggtctctctaggactttactttggggatcaagcttacctcaagagcagctgg
aatattctggatgggtttcttgtctttgtatccctcgttgatattgtggtgtccgtagca
tctgctggcggagcaaaaattctgggtgtcttaagggttcttcgacttttgaggacattg
cgacctctcagggttatcagcagagcacctggtctgaagctggtggtagagaccctgatt
tcttctctaaaacccattggaaacatagttctgatctgctgtgccttctttatcattttt
ggaatccttggtgtgcagctttttaagggtaaatttttctactgccttggtgtggatgtt
cgaaatgtcaccaataagtcagactgtgaggcggccaattacaaatgggtgcatcataaa
tacaattttgataacctgggacaggcgttaatgtcactttttgtcttggcatcaaaagat
ggatgggttaacataatgtataatggactagatgctgtagcagtggaccaacagccagtg
accaatcacaatccatggatgttgctgtactttatctcgttcctgctgattgtcagtttc
tttgtactgaacatgtttgtgggtgtcgtggtagagaactttcacaaatgtcggcagaac
caggaagcagaggaggctcgaagacgagaagaaaaacgattgcgacgcctggagaaaaaa
cgaaggaaagcccagcgtttaccgtactatgccacctattgtcctgctcgccttcttatt
cattcaatgtgcaccagccactacttggatattttcattacaatcatcatttgccttaac
gttatcacaatgtccttggagcactatagtcaaccaaggtctcttgaaattgctctaaag
tactgtaactacatgtttactacagtctttgtacttgaagccgtgctgaagctggtggcc
tttggatttagacgtttcttcaaggacaggtggaaccaactggacctggccattgtgctc
ctgtctgtgatggggatcattttagaagaaatcgaaataaatgctgctttgcccatcaat
cccaccattattcgcatcatgagggtgctgcgcatcaccagggtgctgaagctgcttaaa
atggcaacgggcatgagggcactattggacactgtggtacaagctctgcctcaggtagga
aacttgggactgctcttcatgcttctcttcttcatctatgctgctctgggagtggagctt
ttcgggaaacttgtttgcaatgctgatcacccatgtgaaggaatgagtcgccatgccaca
tttgagaattttggaatggccttcctgactctttttcaggtttctactggggacaactgg
aatggaataatgaaggatactttgcgtgaatgcaccaatgatgatcgcagttgcttgagc
agcctccagttcatctcgcctttgtactttgtgagctttgtgctcacagctcagtttgtg
ctcattaacgtagtagtggctgtgttaatgaaacacctggatgacagcaataaagaagcg
caggaggacgctgagctggatgcagagatagaaatggagttggctcatggcctttgttct
caaacatcaccagtttctgggttagataatgggggacgcggaggaagaccggccactgaa
agtcatcgcagcttaaggtgtttttctcctgctcaggagaatttgtggttggatagtgtt
tccttaattattaaggactcctttgaaggcgaattaacgattattgataatttatctgga
tcagtcttccaccattactcctcaccagccatctgtgagaagtgcaaccacgacaaacaa
gaggtccagctggcagaaatggaggccttttctttaacctctgacaagtcctcgtcagta
ctgactgatgaactcagttcagaagatcaaggtgtcacgagtcagttaaaggagatgaag
gatgggcaagatagcccggactccttgggaatgtttggtgaaaacatcttcccgcttgca
agcattcctggttccccaacagccgagcgctttatatgtgagtttgagaaggtgtctcta
accccggcagagtcctgggacagctggctcaaagaagaaagcgaccctgtctctccttcc
ccgctatgtaccgatacaatgagccctcttttaccagttccatctgaatttttccatcct
ggtatctctgcgcctgaaacagatcgagagattccaaacaccatagataatgatcccaaa
cggccttctcaagaatcatgggccacactgcgttccccgggtatcaactgctcacttctt
cggcaggccgcagaaagcaattcatctatggaaagtggtagtgcaacatctgaggacagc
ttacagaccacattggaagatagcctaaatcttagtgactcgccacagtgcacattggac
ctcccagatctccgtgcaacacctgcatcgcaccatactccattacctataacatctcta
tccatgattcaaaggaggggtaaccgccctagctttgcccttcagaacgttcgacgtcat
caacggagccatagcagtggtgggagcactagtcctggatgtactcttcatgattccatg
gacccttctgatgaagaaggggcaggtggaagcctgcgaggtgcaaacgagccctctgag
acttttagcagcttatctctgacctccctcttttcaccgactccttctttagcaccaccc
gggggtacgattaaaaaatgcagcagtgtcaatagtctttctgttgctccttctagggta
agaggagcaaagcaattttacactgttgatcaacagggcttcctttcaatgccatcttgg
gtgatggatttttaccaaacttctagtccctcagaaaaccaagagaatagtagcagtacc
gaaaagttaccaactatggaaaaggggttaccacccagtagtgtctcaggaaatgcggat
tttggcaataacagtcgacgaaacagatga

DBGET integrated database retrieval system