KEGG   Xenopus laevis (African clawed frog): 108715040Help
Entry
108715040         CDS       T01010                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00561  Glycerolipid metabolism
xla01100  Metabolic pathways
Module
xla_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    108715040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    108715040
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108715040
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S33
   108715040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Lipase_3 DLH Peptidase_S9 Abhydrolase_2 PGAP1 Abhydrolase_5 LIDHydrolase Esterase DUF2974 Thioesterase Abhydrolase_3 LIP
Motif
Other DBs
NCBI-GeneID: 108715040
NCBI-ProteinID: XP_018115381
Position
4S
AA seq 303 aa AA seqDB search
MMPEGSTPALSPQGVPYTELSHFINADGQHIFSRYWKPSGSPRPSTPLLNCFYFNEECAY
PTKVFFLLACTVGHGQSEGERMTVHDFHIFVRDSIQHLDLMKKQYPDLPIYMCGHSMGGA
IAILTVNERLDDFSGLILISPLVLPNPQSATSCKVFAAKLLNYVLPNLSLGSIDPNFVSR
DKKEVDAYTSDPLVYHGGLKVSFGVQLLNATSRVEKALPHFKIPVLLFHGTMDKLCDIRG
SHVMIDTIQSEEKTLKVYEGAFHALHKELPEVTSSVFQEIENWLQKRLGSRGISNVVQQE
SST
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctgaaggtagcaccccagctctcagtcctcagggggtcccgtacacagaactg
agccacttcattaatgcagatgggcaacacattttctccagatattggaagccttcaggt
tcaccacgaccttcaaccccattgttaaactgtttttattttaatgaagagtgtgcatat
ccaaccaaggtcttttttcttcttgcttgcacagttggccatgggcagagtgagggggag
cgaatgaccgtccatgatttccatatctttgtaagagacagcatacaacacttggacctc
atgaagaaacaatatccagacctgccaatatatatgtgtggacattccatgggaggagcc
attgccatcttgactgttaatgagagactggatgacttttctggattaattctaatatct
cccttggtgttgccaaacccacaatctgcgacttcatgcaaggtttttgcagctaaactg
ctgaactatgtcctcccgaacctttccttgggcagcattgatccaaactttgtatctcgc
gataaaaaagaggtcgatgcatatacctcagatccattggtttaccatggaggactgaag
gtttcctttggtgtgcagttgctaaatgccacatctcgggtggagaaagctctcccgcac
tttaagattccagtcctgttgtttcatggcaccatggacaagttgtgtgatattcgtggc
tcccacgttatgatagacaccatacaaagtgaggagaagacactaaaggtatatgaagga
gctttccatgctttacataaagagctgccagaggtcacctcttctgtattccaagagatt
gagaactggcttcagaaaagattgggaagcagaggaatcagcaacgtggtgcagcaagaa
tccagcacatag

DBGET integrated database retrieval system