KEGG   Xenopus laevis (African clawed frog): 108715146Help
Entry
108715146         CDS       T01010                                 

Definition
(RefSeq) dual specificity protein phosphatase 2-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108715146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    108715146
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     108715146
    3.1.3.48  protein-tyrosine-phosphatase
     108715146
Protein phosphatases and associated proteins [BR:xla01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    108715146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 108715146
NCBI-ProteinID: XP_018115525
UniProt: A0A1L8GCV6
Position
4S
AA seq 423 aa AA seqDB search
MPPVPLEERSAPLPRPRSLPLHPPPNPRLAPEVRGFQLGHRAPSHADLTLPGPLPHLQSA
RWPRESCTRRRCSPPSPSPRSPSCFRWALHPLKCGCRGCWRLLRPSRKSVGSSCSCDPIV
TFDPQFAGSSRVSYDEDDDYSVRAIWPDELARKMMSQTRGGTLGGAPLLLDCRGLATIRG
DESMTSTSPLSPPPPSSSSPPLSPIRGSNRNLQSLYLLLEPFSDKENSCEKKALPEPPAD
ECTLPAELSLTSPLSPDLEKAELSSILPFLFLGNEIDAQDLNRMVNLNIGHVLNVTTHLP
LYHAESGALRYKRLPATDNSKQDLRQYFEEAFEFIEEAQQDGKGVLIHCQAGVSRSATIV
IAYLMKHTLMTVGDAYKFVKGKRPIISPNLNFMGQLLEFESDLNTGVTPRILVPKLRGVE
TDV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctgtgcctctagaagagcgttcagcccctttgccccgtccccgttctcttcct
ctgcatcctcctcccaaccctcgcttagccccagaagtcagaggattccaacttggacac
cgtgcaccctctcatgccgaccttacacttcctggacccctgccccatcttcagtctgca
cgatggcctcgggaatcctgcacccggagaagatgttctcctccatcaccatctccacgt
tctccatcttgctttcgctgggctcttcatcctctaaaatgtggttgcagaggttgctgg
cgtcttctgcgaccatccaggaaatctgtgggctcatcttgcagctgtgaccccattgtc
acatttgacccccagtttgctggcagttcgagggttagctatgatgaagatgatgattac
agtgtacgagccatttggccagatgaacttgcacggaagatgatgtcacaaaccagaggt
gggacacttggaggggcacctttgcttctagactgcagggggctggcaacaatacgggga
gatgaatcaatgacttcaacttctcctctttctccaccaccaccatcatcatcatctcca
cctttgtctccaatcagaggatcgaaccggaacttgcaaagtttgtatctccttctggaa
ccattcagtgacaaggaaaacagttgtgaaaagaaagctctgcctgagcccccagctgat
gaatgcacattgccagcagaactatcactcacatcaccgctctctcctgacctggaaaaa
gcagagctgagttccattttgcctttcctctttcttggcaatgagatagatgctcaagat
ttaaaccgtatggttaacctcaacattggccatgttttaaatgtgacgacccatctgccc
ctatatcatgccgagtctggggccctacgatacaagagactgccggctacagataacagc
aagcaggaccttcggcagtacttcgaggaagcatttgagttcattgaagaggctcagcag
gatggaaaaggagtactcatccactgccaggcaggggtctcacgctctgccaccattgtt
attgcgtaccttatgaagcacaccttgatgacagtgggggatgcctataaatttgtcaaa
gggaagcgaccaatcatctcccccaacttgaacttcatgggacaactgctggagtttgaa
tcagatctgaatactggagttaccccgaggatcctggtccccaagctacggggtgttgag
actgatgtgtga

DBGET integrated database retrieval system