KEGG   Xenopus laevis (African clawed frog): 108717362
Entry
108717362         CDS       T01010                                 

Gene name
erap1.L
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 L homeolog
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    108717362 (erap1.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108717362 (erap1.L)
Peptidases and inhibitors [BR:xla01002]
 Metallo peptidases
  Family M1
   108717362 (erap1.L)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 108717362
NCBI-ProteinID: XP_018120018
Xenbase: XB-GENE-6488349
Position
1L
AA seq 952 aa
MQPVPSLIILQIYKQPRRLKKMLNTAKSRRIRGFPLCVVVLYFICTSFSIQPTLAASEAT
ENAKKFPWENLRLPQFAAPFHYDLQIHPNLTTFTFTGLTKVMVTVTQKTSFLVLHSKNLE
ITKTSIERKMGKNPVLQDLLLLEHPVNEQIALLTADPLIPGENYTIYIEYNANLSQSFRG
FYKSTYRTKDGEVRVLASTQFEPTAARTAFPCFDEPAFKASFSIQIRREPKHHAVSNMPI
VKTVNIGGGLLEDYFAVSVKMSTYLVAFIVSDFKSISQVTDHGVTISVYAVPEKIDQAEY
ALKAAVKLLDFYEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRETMLLHDPKTSTA
SHKLSVTMVIAHELAHQWFGNLVTMDWWNDLWLNEGFAKFMEYVSVRVTYPELQVEDYFL
DKCFQAMDVDSLNSSHAVSTPVENPEEIQEMFDEVSYDKGACILNMLMDYMGAESFEAGI
VSYLRRYSYRNARNEDLWNSMTDVCPSDETNNGYCTKTRQTSHWTKGNIIDVKSMMNTWT
LQKGFPLVTVTVKGKYVYLHQEHYLKGSIDTEASGLLWHIPLTYITSKSNVVQRFLLTNR
TDVLVLAEEVEWIKFNVGMNGYYIVHYEGEGWDALIQLLQKNHTATSSNDRANLINSAFQ
LVSIARLPIDKALSLSLYLKNEDKIMPVFQGMDELIPIYKLMERRDMQEVENQMKNYILN
LFRKLIDAQSWTDEGSVSERMLRSSLLLFACVRKYQPCVQKAEEYFKRWQESNGTISLPR
DVALAVYAVGAQTNEGWDFLFEKYKTTLSGSEKNQIQLALTITSLKHKLQWLMEEGMKGD
HVRTQDLPHIVLCVSRNPVGHTLAWEFLKNNWGNLVQKFELGSRTIGSMVVGITKQYSTR
EWLKEVTGFFDSLKEMGSQLRCVQQAKETIEENIRWMDKNFDLVKGWLENNS
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgcaaccggtaccctctctgattattctgcagatttataaacagccaaggagactgaag
aaaatgcttaacactgcaaagtcaagaagaataagaggcttcccattatgtgttgtggtt
ctgtactttatttgcacatcttttagcatacagcctaccttagcagctagcgaggcaacg
gaaaatgcaaaaaaatttccttgggagaacctaaggttacctcaatttgcggctcctttt
cattatgaccttcaaatccatcctaatctaaccacttttacatttactggccttaccaag
gttatggttacagtaacccagaaaactagctttttggtccttcatagtaaaaatttggaa
attacaaagacaagtatagaaagaaaaatgggaaagaacccagtgcttcaggacctgttg
cttcttgagcatcctgtaaatgagcaaattgcacttcttactgctgatccattaattcct
ggagaaaactatacaatctacattgagtataacgccaacctttcacagagttttcgtggc
ttttataaaagtacctacagaactaaagatggagaggtcagagtacttgcatcaacccaa
tttgagcctacagctgcaagaacagccttcccgtgttttgatgagcccgccttcaaagct
agcttctcaattcaaatccgaagagaaccaaagcaccacgctgtgtctaacatgcctata
gtgaagacagtgaatattggaggagggctgcttgaggactattttgctgttagtgtgaag
atgagcacatacttggtggcctttattgtctcagactttaaatcaatcagtcaagtaaca
gatcatggagttacgatttctgtgtatgctgttccagagaagatagatcaggcagagtat
gcgctaaaggcagctgtaaaattgttggacttttatgaagactacttcaacattccatac
cctttaccaaaacaggatctggctgcaatacctgatttccaatctggtgctatggaaaac
tggggtctgacaacctacagggagaccatgttgcttcatgatccaaaaacatcaaccgca
tcacataaactctcggttactatggtaattgcccatgagctggcacatcagtggtttggg
aatttggtaacaatggattggtggaatgacctttggcttaatgaaggctttgctaaattt
atggaatatgtttcagtcagagttacctatccagagctgcaagtggaggactatttcttg
gacaaatgctttcaagctatggatgttgattcactcaactcctctcatgctgtgtctaca
cctgtggagaacccagaagagatacaagaaatgtttgatgaggtctcatatgataagggt
gcctgcattcttaatatgctaatggactacatgggtgcggaaagctttgaagctgggatt
gtgtcttacttacgtcggtacagttaccgcaatgctaggaatgaagacctgtggaacagc
atgactgatgtttgcccctcagatgagacaaacaatggatactgtacaaagacacgccaa
acatctcactggaccaaaggtaatattattgatgtaaagtcgatgatgaatacttggact
ttacaaaaaggtttcccattggtgactgtaacagtgaaagggaagtatgtttatcttcat
caggagcattatctgaaagggagcattgatactgaggcatctggattactttggcatatt
cctttgacgtatatcacaagcaaatctaacgtggtgcaaagatttctgctgaccaataga
acagatgtcctagtcctggctgaagaggtggaatggataaagttcaatgtggggatgaac
ggttactacattgtacattatgaaggggaaggttgggatgcattaattcaactcctgcag
aagaaccacacggctaccagcagcaacgaccgagccaatctcattaatagtgctttccaa
ctagtaagcattgctcgattgcccattgacaaagctctcagcctttctttgtatttgaaa
aacgaagataaaataatgccagtattccaagggatggatgagctgattccaatatacaaa
ctaatggaaaggagagatatgcaggaagttgaaaatcaaatgaagaactatatcctaaat
ctgtttcgcaagttgatcgatgcccagtcctggacagatgagggcagtgtttcagagaga
atgctgcgcagctcactgctcctgtttgcctgtgtgcgcaagtaccagccgtgtgtgcag
aaagcagaggagtattttaagagatggcaggagtccaatggaacaataagcttgccgcgg
gatgttgcattagctgtttatgctgtgggtgctcagactaatgaaggatgggacttcctc
tttgagaaatacaagacgactctctcaggaagtgaaaagaaccagatccaactagcgctg
accatcacttctcttaaacataagttacagtggcttatggaagaagggatgaaaggggat
catgtcagaacacaagacctcccccatattgtcctgtgtgtgagtaggaacccagtgggt
catacattggcttgggagttcctcaagaacaactggggcaacttggtgcaaaagtttgag
ctgggatctcgtactattggcagcatggttgttggaatcacaaagcagtattcaactaga
gaatggctgaaagaggttaccggattcttcgactcattaaaggaaatggggtcccagctg
cgctgcgttcaacaagcaaaggagacaattgaggagaacattagatggatggataagaac
tttgatcttgttaaaggctggttagagaataacagctag

DBGET integrated database retrieval system