KEGG   Xenopus laevis (African clawed frog): 108718757Help
Entry
108718757         CDS       T01010                                 

Gene name
crem
Definition
(RefSeq) cAMP-responsive element modulator-like
  KO
K09052  cAMP response element modulator
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xla00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108718757 (crem)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    108718757 (crem)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108718757 (crem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 Rh5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 108718757
NCBI-ProteinID: XP_018122654
Position
6L
AA seq 107 aa AA seqDB search
MAVTGSYAATGDMTVYQIRSPASSLPQGVVVAASTNNLHNPQVMAEEVTRKRELRLLKNR
EAARECRKKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKTD
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcactggcagctacgcagccacaggagacatgactgtgtatcagatccgctcc
ccggcttcttctttacctcaaggagttgttgtagctgcaagtacgaacaacctgcacaat
cctcaggttatggcagaagaagttacccggaaaagagagttacggctactgaaaaaccgg
gaagctgcccgggagtgccgcaaaaagaaaaaggaatacgtgaaatgccttgagaatcgc
gttgccgtactggaaaaccaaaacaagactctgatcgaggaactgaaggccctcaaagat
ctctactgtcataaaacagattga

DBGET integrated database retrieval system