KEGG   Xenopus laevis (African clawed frog): 373815Help
Entry
373815            CDS       T01010                                 

Gene name
tgfbr2.2.L, tgfbr2, tgfbr2-A, tgfbr2.2
Definition
(RefSeq) transforming growth factor, beta receptor 2, gene 2 L homeolog
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04144  Endocytosis
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04520  Adherens junction
xla04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    373815 (tgfbr2.2.L)
   04350 TGF-beta signaling pathway
    373815 (tgfbr2.2.L)
   04068 FoxO signaling pathway
    373815 (tgfbr2.2.L)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    373815 (tgfbr2.2.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    373815 (tgfbr2.2.L)
  09143 Cell growth and death
   04218 Cellular senescence
    373815 (tgfbr2.2.L)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    373815 (tgfbr2.2.L)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    373815 (tgfbr2.2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    373815 (tgfbr2.2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     373815 (tgfbr2.2.L)
Protein kinases [BR:xla01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   373815 (tgfbr2.2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 373815
NCBI-ProteinID: XP_018091098
Xenbase: XB-GENE-6252417
Position
9_10L
AA seq 555 aa AA seqDB search
MGSRLSALDIHCIPYISYPYVPSLYPTVMAASHSNMRTNVCKWCDNSHPVCDGGICLTNC
SLSSYCENPEEICVTIWKEENESLQLSTRCHHPLLLLENFLVPNYNTSLCVMSAMPSVSG
RLYTCACTEEQECNDKLIFYNQSNGFSMLHSREVVPVAAISLLPPFLCAVMVTVLFYLYR
TQRLSKIPHSWPDKRGHCPEELIEARRTDEYNCRLSSVLISNSPSDMSPMCANSINHNTE
LLPIELDQRVGKGRFAEVWRAKLRHSAPGHYEMVAVKIFPCQEFSSWKNESRIFADANLK
HKNVLQFITTEIRGTSLQKEYWIITTYHAKGNLKDYLASHFLNWTTFLKMAGSIVNGVAH
LHSDCTPCGAMKIPIAHRDIKSTNILVKSDCECVVCDFGIAVRLDPSLTTEDFANSGQVG
TARYMAPEVLESRVNLEDLESFKQMDVYSLSLVLWELATRCDASGEVRSYELPFGSKVRE
QPCVETMRDLVLHGRVRPEIPDTWRRHPGLDVLCDTITECWDHDPEARLTVHCVAERFKL
MAQMECDAMNHHSSG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggggagcagattatcagccctcgacatccactgcatcccctatatttcttacccatat
gtcccctctctataccctacagtgatggccgcctcccacagtaacatgaggaccaatgtg
tgtaagtggtgtgacaactcccaccctgtttgtgatgggggcatctgcctgaccaactgc
tccctgagctcctattgtgaaaatccagaggaaatctgcgtcaccatttggaaggaggaa
aacgagagcctccagctcagcacccgatgtcaccaccccctcctgctgctggaaaacttc
ctggtgcccaactacaacaccagcctctgtgtcatgagcgccatgccctccgtatctggg
cgactctacacatgtgcatgcacagaagaacaggaatgcaatgacaagctcatcttctac
aaccagagcaatggattctccatgttacacagcagggaggtggttcccgtggctgcaatt
agtctcctcccaccatttctatgtgctgtgatggtgacggtactgttctacctgtatcgg
acccaaaggctcagtaagataccccactcctggccagacaaaaggggacactgcccagag
gagcttatagaggctagaaggacagatgaatataactgtagattgtcttctgtactgatc
agcaattcaccctcggatatgagcccaatgtgtgccaacagcatcaaccacaacactgaa
ctgctacccattgagttggaccaacgtgttggcaagggtcgattcgcagaggtgtggcgg
gccaagctgcgacacagtgcgcctggtcactatgagatggtggcagtgaagatctttcct
tgccaagagttttcttcctggaaaaatgagagtcggatttttgccgatgccaacctgaaa
cacaagaatgtgctgcagttcataacaacggaaatccgtggcaccagtctccaaaaggaa
tattggatcatcaccacttaccatgccaagggcaacctgaaagattacctggctagccat
tttctgaactggaccaccttccttaagatggctggctccattgtgaatggtgtggcccat
ctgcacagcgactgtaccccttgtggtgccatgaagatccccattgctcaccgggacatc
aagagcaccaacatcctggtgaaaagtgactgtgagtgtgttgtgtgtgactttgggatt
gcagttcggctggacccttctctcaccacagaggatttcgctaacagtgggcaggttggc
acagccaggtatatggccccagaagttttggagtcacgggtgaacttggaagatctggaa
tctttcaaacagatggatgtctactctctgtcgctggttttgtgggaactggccactcgt
tgtgatgcctccggagaggtgaggagctatgagctaccatttgggagcaaagtgcgagag
cagccatgtgtggagaccatgagggacctggtgttgcatgggcgtgtccggccagaaatt
cctgacacttggaggagacatccgggactggatgtgctgtgcgatacaatcactgagtgc
tgggaccatgaccctgaggcccgtcttactgtccactgtgtggctgaacgttttaaacta
atggcccaaatggagtgtgatgcaatgaaccatcactcaagtggctga

DBGET integrated database retrieval system