KEGG   Xenopus laevis (African clawed frog): 378568
Entry
378568            CDS       T01010                                 

Gene name
noct.L, ccr4l, ccrn4l, ccrn4l-a, noc, noct
Definition
(RefSeq) nocturnin L homeolog
  KO
K18764  nocturnin [EC:3.1.3.108]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xla03019]
    378568 (noct.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.108  nocturnin
     378568 (noct.L)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     378568 (noct.L)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-GeneID: 378568
NCBI-ProteinID: NP_001079281
Xenbase: XB-GENE-6252647
UniProt: P79942 A0A1L8HUQ9
Position
1L
AA seq 388 aa
MDAQLTYTMGLLEQGYLSARVCSMGNSTSRLYSALAKTLSSSAAVSQELLEASQHDQSEP
LDPKELLDECQVALQDRPARLHRDFFSLRSESSSQQPRTFRVMQWNILAQALGEGKDNFI
MCPMEALKWEERKYLILEEILMYQPDVLCLQEVDHYFDTFQPILSRLGYQCTFLAKPWSP
CLDVEHNNGPDGCALFFLQDRFQLVNSAKIRLSARTLKTNQVAIAETLQCCETGRQLCFA
VTHLKARTGWERFRLAQGSDLLDNLESITQGATVPLIICGDFNADPTEEVYKRFASSSLN
LNSAYKLLSEDGESEPPYTTWKIRTTGESCHTLDYIWYSQHALRVNAALGLPTEEQIGPN
RLPSFNYPSDHLSLVCDFSFNEDPARLL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggatgcacagctcacrtacaccatgggcttgttggagcagggatacctgtcagcgaga
gtttgttccatgggaaacagcaccagcagactgtacagcgctcttgccaagacgcttagc
agtagtgccgctgtgtcccaggagttactggaagcctcccagcatgaccagtctgagcct
ctggatcccaaggagcttctggatgagtgccaagtggccctgcaagaccggccggcccgg
ctccaccgagactttttcagcctgaggagcgagtcaagcagccagcagccacgcacattt
cgagtgatgcagtggaacattctggcacaagctcttggtgaaggcaaagacaactttata
atgtgccctatggaggccttgaagtgggaggaaaggaaatacttgatcctggaggaaatc
ctgatgtaccagcctgatgtattgtgtctgcaggaagtagatcactactttgataccttc
cagcctatactgagcagattgggctaccagtgcactttcttggccaaaccatggtctccc
tgccttgatgtggaacacaacaatgggccagatggctgtgccttgttcttcctgcaggat
agattccagctggttaacagtgccaaaatcaggctgtcggccagaaccttaaagaccaac
caggtggccattgccgagaccctgcagtgctgtgaaactggaaggcaactgtgctttgcg
gtcacccatctaaaggcacggacgggatgggagaggtttaggctggcacaaggctctgac
ctactagacaacctagaatcgattacccagggtgccacagttccactcattatttgtgga
gacttcaatgcagaccctacagaggaagtgtacaaaagatttgcctcctccagcttgaac
ctaaacagcgcctacaagttactgagtgaagatggcgaatccgaaccaccctacactacg
tggaagatccgcactacaggagagtcatgccacactctggattacatctggtactcccag
catgccttgagggtaaacgctgctttaggtctgccaactgaagagcagattgggcccaac
agactcccttctttcaattatccctccgatcacctgtcgttagtgtgtgactttagtttt
aacgaagacccagccagattattataa

DBGET integrated database retrieval system