KEGG   Xenopus laevis (African clawed frog): 378608
Entry
378608            CDS       T01010                                 
Symbol
crhr2.S, CRF2, crfr2, crhr2, crhr2-A
Name
(RefSeq) corticotropin-releasing factor receptor 2 precursor
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    378608 (crhr2.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    378608 (crhr2.S)
G protein-coupled receptors [BR:xla04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    378608 (crhr2.S)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 378608
NCBI-ProteinID: NP_001079300
Xenbase: XB-GENE-990954
UniProt: O42603
Position
6S:6826396..6973573
AA seq 413 aa
MDSTIFEIIIDEFDANCSLLDAFQDSFLHSESSSFFGFEGPYCSATIDQIGTCWPRSLAG
ELVERPCPDSFNGIRYNTTRNVYRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALI
INYLGHCISILALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHNIHE
SNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPI
IVTWAICKLFYENEQCWIGKEPGKYIDYIYQGRVILVLLINFVFLFNIVRILMTKLRAST
TSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVF
YCFLNGEVRSAARKRWHRWQDHHSLRVRVARAMSIPTSPTRISFHSIKQTAAV
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggacagcaccatctttgagattatcattgatgaatttgatgccaactgcagccttttg
gatgcttttcaggacagttttttgcactctgagtcctcctctttctttggctttgaaggt
ccctattgtagcgctaccattgaccagattggcacgtgctggcccaggagcctagccggg
gaacttgtggaaagaccctgcccggattccttcaatgggatcagatacaacacaactaga
aacgtctacagagaatgctttgagaatggaacctgggcgtcctggatgaattactctcag
tgtgtgcccattctggataataagaggaagtacgcccttcattacaagattgctctcatc
ataaactacctggggcactgcatctccatcttggctctcgttatcgctttcttgctcttt
ctgtgtttgaggagtataagatgccttcggaacattatccactggaatttaatcactact
ttcatcctgaggaacatcatgtggttcctgctgcagatgattgaccataacattcatgaa
agcaacgaggtctggtgtcggtgtatcacaactatttacaattactttgtggtgaccaac
ttcttctggatgtttgtggaaggatgttacctacacacagctatagtgatgacatactca
acggacaaacttaggaaatgggtgttcctcttcataggatggtgtattccatctccgatc
attgtcacctgggccatctgcaagcttttctatgaaaatgaacagtgttggattgggaag
gagcccgggaaatacattgattacatttaccagggccgggtgattctcgtacttctgata
aattttgtgttcttattcaacattgtaagaattttgatgacaaaactgagagcttcaact
acatctgaaacgatacagtacaggaaggctgtgaaggcaacgttagtccttctccctctt
ctgggaatcacctacatgctcttcttcgtcaaccctggagaggatgacgtttctcagatc
gtttttatttacttcaactcgtttcttcagtcctttcagggtttctttgtgtcagtattt
tactgcttccttaatggggaggtccggtcggctgcaaggaaaagatggcaccgctggcaa
gaccaccattctctgcgggttcgggtagccagagccatgtccataccaacatcaccgacc
agaatcagctttcacagtataaagcaaacggcagccgtctga

DBGET integrated database retrieval system