KEGG   Xenopus laevis (African clawed frog): 379130Help
Entry
379130            CDS       T01010                                 

Gene name
cdc20.S, X-FZY, cdc20, fizzy1
Definition
(RefSeq) cell division cycle 20 S homeolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
xla04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    379130 (cdc20.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    379130 (cdc20.S)
   04114 Oocyte meiosis
    379130 (cdc20.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:xla04121]
    379130 (cdc20.S)
   03036 Chromosome and associated proteins [BR:xla03036]
    379130 (cdc20.S)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     379130 (cdc20.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    379130 (cdc20.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 379130
NCBI-ProteinID: NP_001079443
Xenbase: XB-GENE-17342063
UniProt: Q8AVG7
Position
4S
AA seq 506 aa AA seqDB search
MAQFAFETDINSILKLDTPITNAPLARWQRKAKEGNCSLNTSANTSTMSPMKTSNRSHSS
SKTPSKTPGKSGQKMQGTPSRAGGDRFIPNRSAMQMDVASFLLSKENEPTDTSPTKKEQQ
KAWAMNLNGFDMEEAKILRLGGRPQNAPEGYQNNLKVLYSQKNTPGSSKKTGRYIPSMPD
RVLDAPDIRNDYYLNLIDWSSQNALAVALNDSVYLWNYATGDIILLLQMENSEEYISSVS
WIKEGHFLAVGTSNSEVQLWDVQQQKRLRNMISHSSRVGALSWNNHILSSGSRTGHIHHH
DVRVAQHHVSTLTGHTQEVCGLKWSPDGRYLASGANDNLVNVWPCVQGDSGEFSPVQTFT
QHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGTCLNSVDTHSQVCSILWSANYK
ELISGHGFAQNQLVLWKYPTMTRVSELKGHTARVLNLAMSPDGCTVASAAADETLRLWKC
FEVDPVTKKEKEKSRSSKSIIHQSIR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtttgcttttgaaacggatattaatagtatcttaaagctggatacacccatc
acaaatgcccctctagcaagatggcagcggaaagcaaaggagggtaactgctcattgaat
acttcagcaaatacaagtactatgtctccaatgaaaacatcaaaccgatcccacagttcc
agcaaaactccatcaaaaacaccaggaaaatctgggcaaaaaatgcaaggtacgccttcc
agagctggaggtgatcgtttcattcccaatcgcagtgccatgcagatggatgttgctagc
tttcttctttctaaagagaatgagccaacagacacttcacccacaaaaaaggagcagcaa
aaagcatgggcgatgaatctcaatggctttgatatggaagaggcaaaaatcttacgactt
ggtggtagacctcaaaatgctcctgaaggctatcagaataacttgaaagtgctttacagc
caaaaaaacacccctggttccagtaagaaaactggcagatatataccttccatgccagac
agagtcctcgatgctccggatatccggaacgactactacctgaacctgattgactggagc
tctcagaatgcccttgctgttgctttaaatgactctgtttacctttggaattatgcaact
ggagacataatactcttgctacagatggagaactcggaagaatatatatcatctgtgtca
tggatcaaagaaggccatttccttgctgtggggacaagtaattcagaagtgcagctatgg
gatgttcagcagcaaaaacgtcttcgtaatatgatcagtcattcgtcgcgtgttggagct
ttgagttggaataaccatattctttccagtggttctcgaacaggtcatattcatcaccat
gatgtcagagtagcccagcatcatgtatctaccctaacgggtcacacacaggaagtttgt
ggccttaaatggtctccagatggccgctatcttgccagtggagcaaatgacaacttggtg
aatgtatggccttgtgttcaaggagattcaggggagttttcaccagtgcaaacattcaca
caacatcaaggagctgttaaggctgtggcatggtgtccatggcaatccaatgtgctagca
actggtgggggaacaagcgaccgacacattcgaatctggaatgtttgctctggaacctgc
ttaaattctgttgatacccattctcaggtgtgttctatactatggtctgccaattacaaa
gaattgatatctggtcatgggtttgcacagaaccagcttgtactatggaaatatcccact
atgaccagagtgtcagaacttaaaggtcacactgctcgagtccttaatctagcgatgagc
ccagatggctgcacagtggcttctgctgctgctgatgaaacgctgcgattgtggaagtgc
tttgaggtggatccagtgactaagaaagaaaaggaaaagtcgcgtagcagcaagagcatc
attcaccaaagcatccgataa

DBGET integrated database retrieval system