KEGG   Xenopus laevis (African clawed frog): 379280
Entry
379280            CDS       T01010                                 

Gene name
celf2.L, brunol-3, brunol3, celf2, celf2-a, celf2-b, cugbp2, cugbp2-a, etr3, napor
Definition
(RefSeq) CUGBP, Elav-like family member 2 L homeolog
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xla03041]
    379280 (celf2.L)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    379280 (celf2.L)
SSDB
Motif
Pfam: RRM_1 RNA_bind RRM_7 PHM7_cyt
Other DBs
NCBI-GeneID: 379280
NCBI-ProteinID: NP_001079593
Xenbase: XB-GENE-963644
UniProt: Q7ZXE2
Position
3L
AA seq 536 aa
MFERTSKPAFVENICVESMRCPKSAVTMRNEELLFSNGTTNKMNGALDHSDQPDPDAIKM
FVGQIPRSWSEKELKDLFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNA
LHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECR
ILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQ
QQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATTPSNLGAFSGIQQMAGMNALQLQN
LATLAAAAAAAQTSATTTNVNPLSTTASALGALTSPVAASTANSSAGAAMNSLTSLGTLQ
GLAGATVGLNNINALAGTVNIAQMLSGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQ
YAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISA
KVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgtttgagcgcacttctaaaccggcttttgttgagaatatctgtgtagaaagcatgcgc
tgtcccaaatctgctgttactatgagaaatgaggagctgcttttcagtaacggcacaacc
aacaagatgaatggagctttggatcactcagaccagccagacccagatgccattaagatg
tttgttggtcagatcccaagatcgtggtcagaaaaagaacttaaggacctttttgagcct
tatggagccgtctatcagatcaatgtccttcgagatcggagtcaaaacccaccccaaagc
aaaggttgttgtttcgtaacgttttatacaagaaaagctgcactagaagcacagaacgct
ttgcacaatattaaaactttacctgggatgcatcatcctattcagatgaaacccgcagac
agtgaaaagtcaaatgctgtggaagacagaaaattgttcattgggatggtttcgaagaaa
tgtaacgagaacgatatcagggtgatgttctctccatttggtcaaatagaagaatgtaga
attcttcggggacctgacgggctgagtcgaggctgtgcgtttgttacattttctacaagg
gcaatggcacagaatgcaatcaaagccatgcaccagtctcagaccatggagggctgttct
tcaccaatagtggtgaagtttgccgatactcagaaagataaagagcagaggcgtctacag
cagcagttagcacagcaaatgcaacagctcaatactgccacttggggaaacctaactggg
cttggaggactgacaccacagtatttagcactcctgcagcaagctaccacccccagtaac
ctgggtgcatttagcggcattcagcaaatggctggcatgaatgctttgcaattacagaat
ttggctactttagcagctgcagcagccgcagcccaaacctcagcaaccaccacaaatgta
aaccctctctctacaacggctagtgcactgggagccctaacaagtccggtggccgcatca
actgctaactcttcagctggagctgccatgaattctttgacatctctgggcacgttacag
ggtctggctggagcaaccgttggactgaataatattaatgcactagcaggtaccgtaaat
attgctcaaatgctctcaggtatggcggctttgaatggaggacttggtgccacaggcttg
acgaatggtacagctggtacaatggatgccctcacccaggcctactcaggaattcaacag
tacgcagcggcggcactgcctacattatacagtcagagtttgttacaacagcagagtgct
gcaggcagccagaaagaagggcctgaaggagcaaatctatttatttaccatcttcctcaa
gagtttggagaccaggacatcctacagatgtttatgccttttggaaatgttatctctgca
aaagtatttattgacaaacagaccaatctgagcaagtgctttggttttgttagctatgac
aatcctgtctctgcacaagctgctatccaggcgatgaatggctttcagatcggcatgaaa
cgcttgaaagttcagctgaaacgctccaaaaatgatagcaaaccttactga

DBGET integrated database retrieval system