KEGG   Xenopus laevis (African clawed frog): 379290Help
Entry
379290            CDS       T01010                                 

Gene name
g6pc.S, g6pc, g6pt, gsd1, gsd1a
Definition
(RefSeq) glucose-6-phosphatase, catalytic subunit S homeolog
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00052  Galactose metabolism
xla00500  Starch and sucrose metabolism
xla01100  Metabolic pathways
xla04068  FoxO signaling pathway
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    379290 (g6pc.S)
   00052 Galactose metabolism
    379290 (g6pc.S)
   00500 Starch and sucrose metabolism
    379290 (g6pc.S)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    379290 (g6pc.S)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    379290 (g6pc.S)
   04920 Adipocytokine signaling pathway
    379290 (g6pc.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     379290 (g6pc.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 379290
NCBI-ProteinID: NP_001079603
Xenbase: XB-GENE-5765525
UniProt: Q7ZXA0
Position
9_10S
AA seq 356 aa AA seqDB search
MEMGMDNLHSTGVYIVKYLQENFIKSQDWFVFVSFAADLKNTFLILFPIWFHLSESVGVK
LVWVAVIGDWLNLVFKWILFGQRPYWWVHETTFFVNSSAPTILQFPVTCETGPGSPSGHA
MGSSAVYYVMAHAVISALLENKTTFRSRFERCALWLFFWSVQVNVCLSRVFVAAHFPHQV
IAGVFSGMLVAEIFNHVQCIYKTSFKRYIYATLFLFFFALGFFLLLKVFGVDLLWTLEKA
KRWCARPEWIHIDTTPFAGLLRNLGVFFGLGLALNTQMYRDSCRRKKGAQFTFRLCCIMI
SLLVLHLFDSLELPADNEILFYFLSFCRSVTVSLAVVAVVPYCISHALQWQKKKFT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagatgggaatggataatcttcatagcactggggtctacattgtaaagtatctccag
gaaaacttcataaagtcacaagactggtttgtttttgtctcttttgctgctgatcttaaa
aacaccttcttaatattatttccaatctggttccacttaagcgagtcggtgggtgtcaag
cttgtctgggtggctgttataggggattggctcaaccttgtcttcaagtggatccttttt
ggacagaggccatactggtgggtacatgaaacaaccttcttcgttaattcctctgctcct
accatcctccagttccctgtgacatgtgagactgggccaggaagcccctcaggacatgca
atgggttcttctgctgtatactatgtaatggctcatgctgtgatttctgctcttcttgag
aacaagactactttcaggagccgttttgagcgttgcgctttgtggctgtttttctggagt
gtgcaggttaacgtctgtctgtctcgcgtatttgtggcagcacatttcccgcatcaagtt
attgctggtgtattttcaggcatgctggttgctgaaatattcaaccatgtccaatgtatc
tataagaccagtttcaaaagatacatatatgctacactttttctctttttctttgccctg
ggattctttttactcctaaaggtttttggagtagaccttttatggacactggagaaggcc
aagagatggtgtgctcggccagagtggatccacattgatactactccatttgctggcctc
cttagaaacttgggtgtcttttttggtcttgggctggcacttaacactcaaatgtacagg
gacagctgtagaagaaagaagggtgcacagttcaccttccgtctttgctgcattatgatt
tctctgctggttctccatctctttgactcattggaacttcccgctgacaacgagattctc
ttctactttctgtccttctgcaggagtgttactgtttccctcgctgttgtggcagttgtc
ccttactgcatatcccatgctctccagtggcaaaaaaagaaattcacatga

DBGET integrated database retrieval system