KEGG   Xenopus laevis (African clawed frog): 379359
Entry
379359            CDS       T01010                                 

Symbol
tubb4a.S, tubb4, tubb4a, tubb5
Name
(RefSeq) tubulin beta 4A class IVa S homeolog
  KO
K07375  tubulin beta
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04145  Phagosome
xla04540  Gap junction
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    379359 (tubb4a.S)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    379359 (tubb4a.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    379359 (tubb4a.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    379359 (tubb4a.S)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:xla04812]
    379359 (tubb4a.S)
   04147 Exosome [BR:xla04147]
    379359 (tubb4a.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     379359 (tubb4a.S)
Cytoskeleton proteins [BR:xla04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    379359 (tubb4a.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   379359 (tubb4a.S)
  Exosomal proteins of colorectal cancer cells
   379359 (tubb4a.S)
  Exosomal proteins of bladder cancer cells
   379359 (tubb4a.S)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 379359
NCBI-ProteinID: NP_001079672
Xenbase: XB-GENE-947413
UniProt: Q7ZWP4
Position
3S:complement(126093844..126106234)
AA seq 444 aa
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEASGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVMDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSVTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEGEEEIA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagggaaatcgtgcacctgcaggcgggccaatgtggaaaccagataggagcaaagttc
tgggaagttatcagtgatgagcatggaattgatcctacgggaagttaccatggagacagt
gatctgcagctggaaagaattaatgtctattataatgaagcttcaggtggaaagtacgtt
cccagggcagttcttgtggacctggagcctggtacaatggattctgttcgttccggccct
tttgggcaaatctttagacccgacaactttgtatttggtcagagcggtgctgggaacaac
tgggctaagggtcactacacagaaggtgcagagttagtggactctgtaatggatgttgta
aggaaggaggccgaaagctgtgactgtctgcagggtttccagctcacccactcattagga
gggggcactggttctggaatgggaaccctgttaattagcaagatccgtgaagagtacccc
gatcgtattatgaatacctttagtgtagtgccctcccctaaagtatctgatactgtagtg
gaaccatacaatgccacactttctgtacaccagttggtagaaaacacagacgaaacctac
tgcatagacaacgaggccctttatgatatctgcttccgcactctcaagctgaccactccc
acctatggtgacctcaaccaccttgttagtgtcaccatgagtggtgtcaccacctgcctt
cgcttcccagggcagcttaatgctgaccttcgtaagctggctgtcaacatggtacccttt
ccacgtctccacttcttcatgccagggtttgcacccttaaccagccgaggcagtcagcag
tatcgttccctgacagtaccagagctaacccagcagatgtttgactccaagaacatgatg
gctgcctgtgacccaaggcatgggcgatacctgacagtggctgcagttttccgtggccgc
atgtcgatgaaggaagtggatgagcagatgcttaatattcagaacaagaacagcagctac
tttgtagagtggatacccaacaatgtcaaaacagcagtgtgtgacatcccaccccgaggt
ctgaaaatggcagctacctttattggcaacagtactgccatccaggagttgtttaagcgc
atctctgagcagttcacagccatgttcaggcgcaaagccttcttacattggtacacagga
gagggcatggatgagatggagttcacagaagctgaaagtaatatgaatgacctggtatca
gaataccaacagtaccaagatgccacagctgaggagggagaatttgaagaagagggagag
gaggaaattgcctaa

DBGET integrated database retrieval system