KEGG   Xenopus laevis (African clawed frog): 379508Help
Entry
379508            CDS       T01010                                 

Gene name
thbs1.S, thbs, thbs-1, thbs1, tsp, tsp-1, tsp1
Definition
(RefSeq) thrombospondin 1 S homeolog
  KO
K16857  thrombospondin 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
xla04145  Phagosome
xla04350  TGF-beta signaling pathway
xla04510  Focal adhesion
xla04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    379508 (thbs1.S)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    379508 (thbs1.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    379508 (thbs1.S)
  09143 Cell growth and death
   04115 p53 signaling pathway
    379508 (thbs1.S)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    379508 (thbs1.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    379508 (thbs1.S)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    379508 (thbs1.S)
Membrane trafficking [BR:xla04131]
 Endocytosis
  Phagocytosis
   Opsonins
    379508 (thbs1.S)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   379508 (thbs1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1 VWC Laminin_G_3 Laminin_G_2 Amnionless Laminin_G_1 PHZA_PHZB
Motif
Other DBs
NCBI-GeneID: 379508
NCBI-ProteinID: NP_001079818
Xenbase: XB-GENE-865586
UniProt: Q7SY84
Position
8L
AA seq 496 aa AA seqDB search
MGMMKGIFLLLMLAMPQTHQAAESGNDDNSVFDLFELTGYNRKAGSRKPEGLHLVKGPDP
SSPAYRIENADLIPPLPEDKFQDLLDAIRADRGFILLATLRQAKKSRGALISVERKDGGG
HIFSLISNGQAGTLDLSLSGERKQQVVSVEDAALADGKWKNITLFVQEDRAQLYIGCDKM
ENAELDVPIQKIFTENLASIARLRVAKGGVKDNFQGVLQNVRFVFGTTLEAILRNKGCPS
MTNSVITLDNAVNGSSPAIRTNYVGHKTKDLHAVCGISCNQLSELFAEMKGLQTLVKSLQ
DQVTKETEINELISKRITMMPGACLHNGVLHKNRDEWTVDSCTECTCQNSATICRKVSCP
LMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCGHGIQQRGRSCDSLNNPCE
GSSVQTRSCHIQECDKRFKQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPC
EEKERQEGTRRYWRRR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggggatgatgaagggaattttcctactgttgatgttggccatgcctcagacacatcag
gcagcagaatctgggaatgatgataacagtgtatttgatctgtttgagttaacgggatac
aaccgcaaggctggctctcgtaagcctgaaggacttcatttagtgaagggacctgaccct
tccagcccagcttatagaattgaaaatgctgacttgatcccaccactgccagaagataaa
tttcaagacttgctggatgcaatacgtgctgatagagggttcatcctgttggctactctg
cgtcaagcaaagaagagtcgaggggcacttatttctgtggagagaaaagatggtggtgga
cacatcttcagtcttatctccaatggccaggctggaaccctagacttaagtttaagcgga
gaaaggaagcagcaggtggtgtctgtagaagatgctgctctggctgatggcaagtggaag
aacatcactctctttgtccaagaagaccgcgcgcaactctatataggatgtgacaagatg
gaaaatgctgagctagatgtgccaatacaaaaaattttcactgagaacctggcaagcatt
gctcgtcttcgagtagcaaagggaggagtaaaggacaactttcagggagtccttcagaac
gtgcgctttgtgtttggaaccacattagaagctattctgagaaacaaaggctgtccaagc
atgacaaactcagtcattactttggacaatgcagtgaacggctcaagcccagccatccga
acgaattacgttggccacaaaacaaaggatctgcatgctgtgtgtggcatttcctgcaat
caactgtccgaactgtttgcagaaatgaaaggcttacagactctggtgaaatctctccag
gaccaagtcaccaaagagacagagataaatgaacttatttctaagcgaataacaatgatg
ccaggtgcttgtctccacaatggagtcttgcataagaatagagatgagtggaccgttgac
agctgcactgaatgcacatgtcagaactcagcaactatatgccgaaaagtatcttgccct
ctgatgccctgcaccaatgccaccattccagatggagaatgctgtcctagatgttggcca
agtgactcagcggatgatgattggtctccatggtcagattggacaccttgctctgtgact
tgtggtcatggcatccagcagagaggacgttcctgcgacagccttaataacccctgtgaa
ggctcctctgtacagacacggtcttgccatatccaggaatgtgacaagagatttaagcaa
gatggtggttggagccattggtcaccatggtcatcatgttcagttacctgcggaagtggt
caaatcaccagaatccgtctctgcaactctcctgttcctcagctgaacggaaagccatgt
gaagagaaagaacgccaagaagggacaaggcggtactggaggcggagatga

DBGET integrated database retrieval system