KEGG   Xenopus laevis (African clawed frog): 379527
Entry
379527            CDS       T01010                                 

Gene name
tm7sf2.L, tm7sf2
Definition
(RefSeq) transmembrane 7 superfamily member 2 L homeolog
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00100  Steroid biosynthesis
xla01100  Metabolic pathways
Module
xla_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    379527 (tm7sf2.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     379527 (tm7sf2.L)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT Steroid_dh PEMT
Other DBs
NCBI-GeneID: 379527
NCBI-ProteinID: NP_001079837
Xenbase: XB-GENE-1005376
UniProt: Q7T0Z1
Position
4L
AA seq 420 aa
MADKIKTPRTSELEFGGPLGALLLLFVMPGTVLYLLVTCNTDDASVLRVPGPFPSLDTLW
DPSAVILLLAWVSLQAVLHILPIGKVTEGITLRDNTRLKYRINALQAMMVTALLVGGAVM
FGFPFSYVYDHFLQLAVAAAFIALVLSIFLYAKSLAAPESALAPGGNSGNPLYDFFIGHE
LNPRIGSFDLKYFCELRPGLIGWCLINLCFMMKEVELRGSPSLSMMLVFGFQALYVADAM
KNEEAILTTMDIVHDGFGFMLAFGDLCWVPFTYSLQGYFLVRHPQELGTYTALGIILLNA
VGYIIFRGSNSQKNAFRRNPSDPKVAGLATIPTATGKRLLVSGWWGLVRHPNYLGDLIMA
LAWSLPCGLSNILPYFYIIYFTVLLVHREARDEHQCMKKYGLAWQEYCRRVPYRIFPYIY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcggacaagattaaaacaccacgtaccagtgaattggagttcggaggaccactggga
gccctactgttactctttgtaatgccgggaacagtcttgtatcttctggtgacgtgtaac
acagatgacgccagtgttttgcgtgtgccgggtccctttccctctttggacactttgtgg
gacccttctgctgtgatcttactgcttgcatgggtgtctctgcaggctgtgctgcatatt
ctgcctattggaaaggtaaccgaaggaattactttaagagacaacactcgtctgaagtac
agaattaacgcattacaagccatgatggtgactgcgctcctagtggggggagcagtgatg
tttgggttcccattctcctatgtttatgatcatttcctgcaactggcagtggctgccgca
tttatagctctagttctcagcatctttctctatgccaagtcccttgcagctcctgaatca
gcgctggcaccgggagggaattcaggtaacccactgtatgatttctttattggacatgaa
ttaaaccccaggattggctcctttgatttgaaatatttctgcgagcttcgccctggactt
attggctggtgcctaattaatctttgcttcatgatgaaggaggttgagcttcgtggctcc
ccatccctctctatgatgctggtgtttggattccaggctctgtatgtcgcagatgccatg
aagaatgaggaagccatcctcactacaatggacattgttcacgatggatttggtttcatg
ttggcttttggtgacctgtgctgggttcctttcacctactcactgcaaggatatttccta
gtcaggcaccctcaggaactgggcacttacactgcacttggcatcatcctactaaatgct
gtgggatatatcattttccgtggctctaactcacagaagaatgccttccgaagaaatcct
tctgaccccaaagttgctgggcttgcaactattccaacagcaactggaaaacgtcttctt
gtgtctggctggtggggccttgttcgtcacccaaattacttaggagatttaattatggcc
ctggcctggtctctgccctgtgggctgtcaaacatcctaccgtatttctatatcatctat
ttcaccgtccttctggtgcaccgggaggcaagggatgaacaccagtgtatgaagaagtat
ggactcgcctggcaggaatattgcagaagggtcccctacagaatttttccgtatatctac
tga

DBGET integrated database retrieval system