KEGG   Xenopus laevis (African clawed frog): 379528Help
Entry
379528            CDS       T01010                                 

Gene name
mars2.L, mars2, metrs
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial L homeolog
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00450  Selenocompound metabolism
xla00970  Aminoacyl-tRNA biosynthesis
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    379528 (mars2.L)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    379528 (mars2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xla01007]
    379528 (mars2.L)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xla03016]
    379528 (mars2.L)
Enzymes [BR:xla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     379528 (mars2.L)
Amino acid related enzymes [BR:xla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   379528 (mars2.L)
Transfer RNA biogenesis [BR:xla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    379528 (mars2.L)
 Prokaryotic type
   Other AARSs
    379528 (mars2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f HTH_29
Motif
Other DBs
NCBI-GeneID: 379528
NCBI-ProteinID: NP_001079838
Xenbase: XB-GENE-5862169
UniProt: Q7T0Z0
Position
8L
AA seq 562 aa AA seqDB search
MLRSLALRTFANILGLSSRSGSTAAMSRNAVASRPHLYTTPIFYVNAAPHLGHVYSALLA
DVQHRYSAMCGIESKLSTGTDEHGMKVQQAASALGLDPQTFCSTVSLQFRTIFDALDISY
TDFVRTTEPRHIEAVSRFWMTLEEQGYIYKGTYEGWYCTSDEAFLSEGQTAEHTDFEGNK
IRVSLESGHQVHWVSEENYMFRLSSLRPALLNWLQTEPVHPAPFLKLVHHWLEEELPDLS
VSRQRSRLSWGIPVPSDSSHVIYVWLDALVNYLTAAGYPNPQLAPWGPSTHLLGKDILRF
HAIYWPAFLIAAGLPPPQKLLVHSHWTSEGTKMSKSLKNVVDPSDCIRRYTTDGLRYYLL
RHGAPERDCDFTHRTARMLLNSELADALGGLLNRCTAPAINPMQHFPKFQYENFPVASRD
QVHDLLGALQELPVEVDQWIKKFQVHKALECIDACVRRSNAFFQSQAPWKLQRGVEKEAA
LRDSVIYLTLEALRLYATLLHPAVPGLATVVLDRLGVPHKMRTLKKNTFLAATRGEICYF
QAQTLGPDKGLLFPRLEKSEAF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctcgctggctttgcgcacgttcgcgaatatacttggattgagtagccgcagc
ggaagcacagcggcaatgagcaggaatgcagtcgcatcccgaccccatttatacacaact
ccaatattctacgtgaacgcagccccccaccttggacatgtatactcggccctgctggct
gatgtgcaacatcgctactccgccatgtgcgggatagagagcaaacttagcacaggtaca
gatgagcatggcatgaaggtacaacaggctgcctcggctcttggtttagacccacagaca
ttttgttctactgtgtctcttcagttccggactatattcgatgctcttgatatttcttac
acagattttgtgcgcacaactgaaccccgacatatagaagctgtgagcaggttttggatg
accttagaagaacaaggatatatttacaaagggacttatgaaggatggtattgcacatcc
gatgaggccttcctaagcgaggggcagacagcagagcacactgactttgagggcaacaag
atccgagtgtctctggagagtggtcatcaggtacactgggtgagtgaggagaactatatg
ttccgtctgtcatctcttcgccctgctctgctaaactggttacagacagaacctgtgcat
cccgctccattccttaaattagtacatcactggctggaggaagaactcccagacctttca
gtgtctagacagcgcagtcgtctatcctggggaatccctgtgccttctgactcctctcat
gttatatatgtttggttagatgctctagtaaattatcttactgctgctggatatcctaat
ccacagttggcaccatggggcccttccacccacctccttggtaaggatattttgcgattc
catgctatttactggcctgctttccttatcgcagctggtcttccgcctccccagaagctg
cttgttcattctcattggacgtcagaaggtacaaaaatgtctaaaagcctaaaaaatgtg
gtggatccatcagattgcattagacgttacacaacagatgggctgcgctactatttgttg
cgccacggtgccccggagagagattgcgatttcacacaccgtactgcccgcatgctgctg
aactccgagttagccgacgcccttgggggcctgctaaaccgttgcactgctccagctatt
aacccaatgcagcactttccaaaattccaatatgagaattttcctgttgcctcccgtgac
caggtacatgatttgcttggtgctttgcaggaactccctgtagaggtggaccagtggata
aagaagtttcaagttcacaaggctttggagtgtattgatgcctgtgtacgacgctccaat
gcctttttccaaagccaggctccatggaaactccaaagaggagttgaaaaagaggctgct
ctgagggactctgttatatacctgacattggaagctcttcggctgtatgccacacttctt
catcctgcagtgcctggactagctacagtggtactggacaggcttggtgtcccccacaag
atgaggacacttaagaagaatacatttttagcagctacaagaggagaaatctgttacttt
caggctcaaactctgggtccagacaaaggcctcctctttcccaggctggaaaagagtgaa
gctttttag

DBGET integrated database retrieval system