KEGG   Xenopus laevis (African clawed frog): 379675Help
Entry
379675            CDS       T01010                                 

Gene name
mars
Definition
(RefSeq) methionyl-tRNA synthetase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00450  Selenocompound metabolism
xla00970  Aminoacyl-tRNA biosynthesis
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    379675 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    379675 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xla01007]
    379675 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xla03016]
    379675 (mars)
Enzymes [BR:xla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     379675 (mars)
Amino acid related enzymes [BR:xla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   379675 (mars)
Transfer RNA biogenesis [BR:xla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    379675 (mars)
 Prokaryotic type
   Other AARSs
    379675 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 GST_C_3 GST_C GST_C_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 379675
NCBI-ProteinID: NP_001079984
UniProt: Q6PF21
Position
2S
AA seq 905 aa AA seqDB search
MKLFVGEGNPQGVKVLAAAALWAQHVQIDRLQQEEKIVPFMSQPRLPVLDLENGNYLFLS
NAICRYFYLSSGHDMCDLSNQWLEWEAAELQPALSAALYAHVVQGKKKEDVMATISASLK
HLDQSLAGKSSPYLIKDALTVVDIVVWGSIYPLIVDASNLPEEMASLKRWFQNVSQLEQC
QKAASSLLKDKGSSVFKPFLQKQPAPITPPGKSVCKEQEGEDMPSLSEEDIQAAAEAWAK
GLTGASKPKQRPHPILPVEGEKNVLITSALPYVNNVPHLGNIIGSVLSADVFARYCRLRN
WNTLYICGTDEYGTATETKAMEEGLTPQQICDKYNAIHTAIYQWFNISFDYFGRTTTQHQ
TTISQDIFHRLLEREFLLTDTVEQLRCEKCQRFLADRFVEGICPFCNYEEARGDQCDKCG
KLINAVELKKPQCKICKQSPVIKSSKHLFLDLPKLEKRLEQWLEQSFSTGDWTSNARFIT
RSWIRDGLKPRCITRDLKWGTPVPLDGFRDKVFYVWFDAPIGYISITANYTDQWEKWWKS
PQQVQLYNFMAKDNVPFHSVVFPSCLLGAEDNYTLVNHLVATEYLNYEDGKFSKSRGVGV
FGDMAKDTGIPADIWRFYLLYVRPEGQDSAFSWSDLMLKNNSELLNNLGNFVNRAGMFVQ
KFFNGCVPEMELLSEDKRLLAQVAAELQQYNLLLEKVRIRDALRCILNISRHGNQYIQVN
EPWKCIKGNQQEQKRAGTVTGVAVNMAALLSIMLHPYMPTISSVIQEQLLMPQESKVLTT
DFCCCLQSGHQIGNVSPLFQKLENDQIESLRKRFGGGQVKTESKVSPSQEAPEQQAPKAS
GPERVKELMQELEKQGNHVRELKGKKAEKSVIDPEVQKLLALKKELALAEGKSPDPPTQK
GKKKK
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtttgtgggtgaggggaaccctcagggggtgaaggtgctggctgccgccgct
ctctgggctcaacatgtacagatcgacaggctacagcaggaagaaaagattgttcctttt
atgtcacaaccaagactaccagtgctggacttggaaaatggaaattatctcttcttatct
aatgcaatctgcaggtacttctacttgtcatctggtcatgatatgtgcgatctaagcaat
cagtggttggaatgggaagcagccgagcttcagccagcactctctgctgcgttatatgca
catgttgttcaggggaaaaaaaaggaagatgtcatggcaaccattagtgcatcccttaag
catttggatcaaagccttgcaggaaaatccagtccataccttatcaaggatgcactcact
gttgtggatattgttgtgtggggctctatctatcctctaattgtggatgcatctaatctt
ccagaagagatggcatcacttaagcgctggtttcaaaatgttagtcagctagaacagtgc
caaaaagctgcgtcatcgctgttgaaagataaggggagctcagtcttcaagcctttcctc
cagaagcagcctgcacccataaccccacctggcaagtccgtttgtaaggagcaagaggga
gaggacatgccgtctctgtctgaggaggatatacaagctgctgctgaagcttgggctaaa
ggtctcactggtgcttcaaagccaaagcagagaccacacccaatcctgccagtggaagga
gaaaaaaacgttctcatcaccagtgctttgccctatgtcaataacgttccgcaccttgga
aatatcattggttctgtgctcagcgcagatgtttttgctaggtactgcaggctgcggaac
tggaacacactctacatatgtggaacggatgaatatggcacagcaacagaaaccaaagct
atggaggaagggttgacaccccaacagatctgtgacaagtacaatgctatccacactgcg
atatatcagtggtttaacatctcttttgactattttggacggacaacaacccaacaccaa
accactatttcccaagatatctttcatcgacttctcgagagggaatttttactgacagac
acagtggaacagcttcgctgtgagaaatgccagaggttcttggctgatcgctttgtggaa
ggaatatgtcctttctgtaactacgaagaggcgagaggggaccaatgtgacaaatgtggg
aagctcataaatgctgtagagttaaagaaaccacagtgcaaaatttgtaagcagtcccct
gtcattaaatcctccaagcatctcttcttggacttgccaaagctggagaaacgtttggaa
caatggttggaacagtccttctctaccggtgactggacatcaaatgcccgtttcataact
cgctcatggatacgtgatggactgaagcctcgttgtatcacacgagatctgaaatggggc
acacctgtgccactggatggtttcagagacaaggtgttctatgtctggtttgatgctccc
attggctatatttctattacagccaactatacagatcagtgggaaaagtggtggaagagt
cctcaacaggtccagctttataattttatggcaaaggacaatgttcctttccacagtgtt
gtcttcccttcctgccttttgggtgcagaagataactacacattggtcaaccaccttgta
gctacagaatatttaaattatgaggatggtaaattctccaagagtcgaggagttggggta
tttggagatatggcaaaggacactggtatccctgcggatatatggagattctacctactt
tatgtgagaccagaaggacaagacagtgctttcagctggagtgatctcatgctcaaaaac
aactctgagctcctcaacaaccttggcaattttgtcaacagggctggtatgtttgtgcag
aagtttttcaatggctgtgttcctgaaatggagctgctttcagaagataagaggcttctg
gcccaagttgcagcagaactgcagcagtacaacctgcttctggagaaagttcgcatccga
gatgctcttcgatgtattctgaacatttcacgtcatggcaatcagtacatccaagttaac
gaaccatggaagtgcatcaaaggaaaccaacaagagcagaagagagcaggcacagtgact
ggagtggctgtaaacatggccgctcttctctccattatgttgcatccatacatgccaaca
atcagcagtgttatccaggagcagctgctaatgccacaagaatctaaagtgttaaccacc
gacttctgctgttgtctgcaaagtggccaccaaattggaaatgtgagtccactgttccag
aagttggagaacgaccagatagaatccttgcgcaaacgctttggaggagggcaggtaaaa
acagagtcaaaagtgtctccatctcaggaagctcctgagcagcaagcacctaaagcctct
gggccagaaagagtgaaggagctgatgcaggagctggaaaaacagggtaaccatgtgcgg
gagctaaaggggaaaaaagccgaaaaatcagtcattgaccctgaggtgcaaaagctttta
gcattaaagaaagaactggcgctcgcagaaggcaagtcaccggatcctcccactcagaag
ggcaagaaaaagaaatag

DBGET integrated database retrieval system