KEGG   Xenopus laevis (African clawed frog): 379991Help
Entry
379991            CDS       T01010                                 

Gene name
map2k1.L, map2k1, mek-2
Definition
(RefSeq) mitogen-activated protein kinase kinase 1 L homeolog
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04270  Vascular smooth muscle contraction
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04540  Gap junction
xla04620  Toll-like receptor signaling pathway
xla04810  Regulation of actin cytoskeleton
xla04910  Insulin signaling pathway
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
Module
xla_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    379991 (map2k1.L)
   04012 ErbB signaling pathway
    379991 (map2k1.L)
   04370 VEGF signaling pathway
    379991 (map2k1.L)
   04371 Apelin signaling pathway
    379991 (map2k1.L)
   04068 FoxO signaling pathway
    379991 (map2k1.L)
   04150 mTOR signaling pathway
    379991 (map2k1.L)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    379991 (map2k1.L)
  Cell growth and death
   04114 Oocyte meiosis
    379991 (map2k1.L)
   04210 Apoptosis
    379991 (map2k1.L)
   04218 Cellular senescence
    379991 (map2k1.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    379991 (map2k1.L)
   04540 Gap junction
    379991 (map2k1.L)
  Cell motility
   04810 Regulation of actin cytoskeleton
    379991 (map2k1.L)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    379991 (map2k1.L)
  Endocrine system
   04910 Insulin signaling pathway
    379991 (map2k1.L)
   04912 GnRH signaling pathway
    379991 (map2k1.L)
   04914 Progesterone-mediated oocyte maturation
    379991 (map2k1.L)
   04916 Melanogenesis
    379991 (map2k1.L)
  Circulatory system
   04270 Vascular smooth muscle contraction
    379991 (map2k1.L)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    379991 (map2k1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     379991 (map2k1.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: STE group
  STE7 family
   379991 (map2k1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 Kinase-like DUF3216
Motif
Other DBs
NCBI-GeneID: 379991
NCBI-ProteinID: NP_001080299
Xenbase: XB-GENE-865216
UniProt: Q05116 A0A1L8H157
Position
3L
AA seq 395 aa AA seqDB search
MPKKKPTPIQLNPNPEGTAVNGTPTAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKVSELGAGNGGVVFKVSHKPTSLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGKIPEKILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELIFGCSVERDPASSELAPRPRPPGRPIS
SYGPDSRPPMAIFELLDYIVNEPPPKLPSGVFGAEFQDFVNKCLVKNPAERADLKQLMVH
SFIKQSELEEVDFAGWLCSTMGLKQPSTPTHAAGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaagaagcctacgcccatacagctgaatcccaaccccgaagggactgctgtg
aacgggacccctacagccgagacaaaccttgaagctctgcagaaaaagttggaagagctt
gagctggatgagcagcagaggaagcgtctggaggcttttctcacccagaagcagaaagtt
ggggaactgaaggatgacgactttgaaaaagtttcagagcttggagcaggcaacggagga
gtggtgtttaaggtgtcccacaagccaaccagcttgattatggccaggaagttgattcat
ctggagattaagcctgcaatccgaaaccagattatccgagagttgcaggttctgcatgaa
tgtaactccccatacattgtggggttctatggggccttctacagtgatggagagatcagc
atttgcatggaacacatggatggaggctcccttgatcaggttctgaagaaagctggcaaa
atcccagaaaagattttgggaaaagtcagcattgcagtgataaaaggtctaacctacctg
agagaaaagcataagataatgcacagagatgtgaaaccttctaacatcctggtcaactct
agaggagagataaaactctgcgactttggggtcagcgggcaactcatagactccatggca
aattcctttgttgggacaagatcctatatgtcaccggagcgactacagggcactcattat
tctgtgcaatcagacatctggagcatggggctgtcgctggtggaaatggccattggaagg
tatcccattccaccccctgatgccaaagagctggaacttatctttgggtgttctgtagaa
agggatccagcatcttctgaactggcacctcgcccccggccacccggacgtccaataagc
tcatacggtcctgatagtcgaccacccatggctatttttgaacttctggattatatcgtg
aacgagccgcctccaaaattgcccagtggagtatttggagctgagttccaggactttgtg
aataaatgtcttgtgaagaatccggcagagagagcagaccttaaacagctaatggttcac
agcttcattaagcagtcagagttggaggaagtggattttgctggatggctctgttccact
atgggccttaagcagcccagtaccccaacccatgccgccggagtgtga

DBGET integrated database retrieval system