KEGG   Xenopus laevis (African clawed frog): 380109Help
Entry
380109            CDS       T01010                                 

Gene name
arg1.L, arg1
Definition
(RefSeq) arginase 1 L homeolog
  KO
K01476  arginase [EC:3.5.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00220  Arginine biosynthesis
xla00330  Arginine and proline metabolism
xla01100  Metabolic pathways
xla01230  Biosynthesis of amino acids
Module
xla_M00029  Urea cycle
xla_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    380109 (arg1.L)
   00330 Arginine and proline metabolism
    380109 (arg1.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     380109 (arg1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 380109
NCBI-ProteinID: NP_001080417
Xenbase: XB-GENE-6254072
UniProt: Q7ZYM1
Position
5L
AA seq 323 aa AA seqDB search
MSSQGKTSVGVIGAPFSKGQPRRGVEEGPKYLREAGLIEKLREFGNDVRDCGDLDFPDVP
NDTPFNNVKNPRTVGKATEILANAVTAVKKADKTCLTIGGDHSLAVGTIAGHAAVHPNLC
VVWVDAHADINTPSTSPSGNLHGQPLSFLMKELKSKMPAVPGFEWVKPCLRSKDIVYIGL
RDVDPGEHYILKTLGIKYYSMSEVDYLKIDKVMEETLEYLVGKHKRPIHLSFDIDGLDPS
IAPATGTPVPGGLTYREGMYITEQLHKTGLLSAVDIMEVNPSRGETKRDVEVTVKTALDM
TLSCFGKAREGFHASTMMLPDIF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccaaggaaagacatcagttggagtcattggagccccattctccaagggacag
ccaagaagaggagtggaagaggggcctaaatatttaagagaggccgggttaattgagaaa
ttaagagaatttggcaatgatgttcgagattgtggggatttggattttcctgatgtgcct
aatgacacaccatttaacaatgtgaaaaacccacgtacagttgggaaagctacagaaata
ttggccaatgctgtcacagcagtaaagaaagctgacaagacatgcctaaccattggggga
gatcacagcttggcagtgggaacgattgccggtcacgcagcagttcaccctaatctctgt
gttgtgtgggtggatgcccatgcagatatcaacactccgtccacatcacccagtggcaac
cttcatggacagccgttatcttttttaatgaaagaactcaaaagcaagatgccggctgtt
ccaggatttgagtgggtgaaaccatgtctccgtagcaaagacattgtatacatcggctta
agagatgtggacccaggagagcattacattctgaagacacttggtataaaatactattca
atgtctgaagtggattatcttaaaatagacaaagtaatggaagagacacttgaatatttg
gttggcaagcataagagacccattcatttaagttttgacattgatggactggacccaagc
atagccccagctactggaacccctgtgcctggaggactgacttacagggaaggcatgtac
atcacagaacaacttcacaaaacaggtttactttcagcagtggacattatggaggtgaac
ccatcgcgcggagaaactaagcgagacgttgaggtcacagttaaaactgctcttgatatg
actttgtcatgctttgggaaagcacgcgaaggatttcatgcatcgaccatgatgcttcca
gatattttctaa

DBGET integrated database retrieval system