KEGG   Xenopus laevis (African clawed frog): 380238
Entry
380238            CDS       T01010                                 
Symbol
csnk1a1.S, ck1, csnk1a1
Name
(RefSeq) casein kinase 1 alpha 1 S homeolog
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    380238 (csnk1a1.S)
   04340 Hedgehog signaling pathway
    380238 (csnk1a1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    380238 (csnk1a1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     380238 (csnk1a1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   380238 (csnk1a1.S)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 Pox_ser-thr_kin APH Kdo
Other DBs
NCBI-GeneID: 380238
NCBI-ProteinID: NP_001080546
Xenbase: XB-GENE-17345862
UniProt: Q7ZY65
Position
3S:complement(106664314..106702040)
AA seq 337 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGPGQQAQTPTGKQTDKSKSNMKGF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaagccgagtttatcgtcggtgggaaatataagctcgtg
cggaagatcggatctggctcctttggagacatttacctggcgatcaatatcaccaatggc
gaggaggtagccgtaaagctggaatcacagaaagctcgccacccccagttgttgtatgaa
agcaaattgtacaagatacttcaaggaggtgttggaatccctcatatccggtggtatgga
caagaaaaggattataatgttctagttatggacttgcttggacccagtcttgaagatctt
ttcaatttttgctcgcgtaggttcacaatgaagacagttcttatgttagcagaccagatg
ataagtagaattgaatatgtacacacaaagaattttatacacagagacattaaaccagat
aactttctaatgggcatcggacgtcactgtaataagttattccttatagactttggtttg
gccaaaaagtacagagacaacaggacgaggcagcacataccttatagagaagacaaaaat
cttactggcacggcccgttatgctagtataaacgctcacctaggaattgaacaaagtcgc
cgtgatgatatggagtccctaggctacgtgctaatgtatttcaacaggaccagccttccg
tggcagggattaaaggcagctacaaagaagcaaaagtatgaaaagataagtgaaaagaag
atgtccactccagttgaggtgttgtgtaagggctttcctgcagaatttgcaatgtatctg
aactactgccgtggcttacgatttgaagaggcaccagactacatgtacctgcgacaacta
ttccgtattctgttcagaacactgaaccaccaatatgactacacatttgactggacaatg
ttaaagcagaaagcagctcagcaagcagcctcctccagtgggccgggccagcaagcccaa
acccccacaggcaagcaaactgacaaatccaagagtaacatgaaagggttttga

DBGET integrated database retrieval system