KEGG   Xenopus laevis (African clawed frog): 380366
Entry
380366            CDS       T01010                                 

Gene name
bcs1l.L, bcs1l
Definition
(RefSeq) BCS1 homolog, ubiquinol-cytochrome c reductase complex chaperone L homeolog
  KO
K08900  mitochondrial chaperone BCS1
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xla03029]
    380366 (bcs1l.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    380366 (bcs1l.L)
SSDB
Motif
Pfam: BCS1_N AAA RNA_helicase AAA_16 DUF815 AAA_25 AAA_5 Rad17 ABC_tran AAA_18 AAA_29 AAA_33 RuvB_N AAA_7 AAA_11 Polyoma_lg_T_C AAA_22 AAA_24 ATPase RsgA_GTPase MMR_HSR1
Other DBs
NCBI-GeneID: 380366
NCBI-ProteinID: NP_001080674
Xenbase: XB-GENE-1015032
UniProt: Q7ZTL7
Position
9_10L
AA seq 419 aa
MPFADFVAALKDNPYFGAGFGLVGVGTALALTRKGAQFGMIAFRRHYMITLEVPSKDKSY
QWLLSWISHYAKNTQHLSVETSYLQHESGRISTKFDFVPSPGNHFIWYRSKWIRIERNRE
KQMIDLHTGTPWESVTFTALGTNRNIFFNILQEARELALKQQVGKTVMYNAVGAEWRQFG
FPRRRRPLSSVVLEQGISEKIVQDVKGFIENPKWYSDRGIPYRRGYLLYGPPGCGKSSFI
TALAGELEYSICLMSLSDSSLSDDRLNHLLSVAPQQSIILLEDVDAAFVSRDLNKQNPTA
YQGMGRLTFSGLLNALDGVASTEARIVFMTTNHIDRLDPALIRPGRVDVKQYVGHCTNWQ
LSQMFLRFYPDQTAGQSEAFASAALSSSDKISAAQVQGHFMMHKTDPDGAIQNVCLATM
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgccttttgctgattttgtagcagctctcaaggacaatccctattttggggcagggttt
ggactggttggcgtgggaacagcgctagctctgacccgtaaaggtgcccagtttggcatg
attgcctttcggaggcattacatgatcactttagaagtgccaagcaaagacaagagctac
caatggttactgagctggatctctcactatgccaaaaatacacagcacttgagtgtggag
acatcctatctacagcatgagagtggtcggatcagcactaagtttgactttgttccaagc
cctgggaaccatttcatctggtacagaagcaaatggatcagaattgaaaggaacagagag
aaacagatgatagacctgcatactggaactccctgggaatctgtgaccttcactgccctg
ggaaccaatcggaatatcttctttaacatcctgcaagaagctagggaactggcactgaag
cagcaggttgggaagactgttatgtacaatgctgtaggtgcagaatggaggcagtttgga
tttcctcgacgcaggcggccattgagttctgttgtgcttgaacaaggaatttcggaaaag
attgttcaggatgttaaaggtttcattgagaaccccaaatggtacagtgacagagggatt
ccctaccgtagaggttatctgctgtatgggccaccaggttgtgggaagagcagctttata
acagctcttgctggggagttggaatacagtatctgcttgatgagtctcagtgacagcagc
ctctcagatgaccgactcaaccacctcctcagtgtcgctccccagcagagcattattcta
ctagaagatgtggatgctgcctttgtgagtcgtgaccttaacaagcaaaacccgactgca
taccaaggaatgggccgcttgacttttagtgggctgctaaacgcactggatggtgtagca
tctactgaagctcggatagtgttcatgacaacaaatcatattgacaggttagacccagca
ctgatacgcccaggccgtgtggatgtgaaacagtatgtgggacattgcaccaactggcag
ctttctcagatgtttttgcgcttctaccctgaccagacggccggacaatccgaggcattt
gcaagtgcagccctgtcctcctctgataaaatcagtgctgcccaggtgcagggtcatttc
atgatgcacaaaactgaccctgatggggccattcagaatgtttgcttggctactatgtga

DBGET integrated database retrieval system