KEGG   Xenopus laevis (African clawed frog): 394292Help
Entry
394292            CDS       T01010                                 

Gene name
efnb1.L, LERK-2, cfnd, cfns, efl3, efnb1, efnb1-A, ephrinB1, eplg2, lerk2
Definition
(RefSeq) ephrin-B1 L homeolog
  KO
K05463  ephrin-B
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    394292 (efnb1.L)
   04052 Cytokines and growth factors [BR:xla04052]
    394292 (efnb1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   394292 (efnb1.L)
Cytokines and growth factors [BR:xla04052]
 Growth factors
  Growth factors (RTK binding)
   394292 (efnb1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin DUF4381 Baculo_11_kDa Glucos_trans_II Orthoreo_P10 EphA2_TM TMEM132D_C Cytomega_TRL10 WBP-1 Syndecan Stevor
Motif
Other DBs
NCBI-GeneID: 394292
NCBI-ProteinID: NP_001080948
Xenbase: XB-GENE-1011784
UniProt: O13097 B7ZQX6
Position
8L
AA seq 329 aa AA seqDB search
MEGLRRLLGLLLVLYRLCSALGKNLEPVTWNSQNPRFISGKGLVLYPEIGDRLDIICPKG
DSSQPYEYYKLYMVRRDQLEACSTVIDPNVLVTCNQPGKEYRFTIKFQEFSPNYMGLEFR
RNQDYYITSTSNSTLQGLENREGGVCQTRSMKIIMKVGQDPNAVPPEQLTTTRPSKEADN
TGKIATFGPWNGPVENPGKSDTNLSDKPTAGGGVDGFFNSKIAVFAAIGAGCVIFILIII
FLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHY
EKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaagggctccggcgtcttctcgggcttttgctcgttctctatcgtctctgctcggcg
ctgggaaagaacttggagccggtcacatggaactcgcagaacccgcggtttatatctgga
aagggcctggttctataccctgaaattggcgaccgcttggacattatctgccccaagggg
gactcttcccagccttatgaatactataaattgtacatggttcgccgggaccagttggag
gcgtgcagcacagtcatagatcccaatgttttggtgacgtgcaaccagcctgggaaggaa
taccgcttcactatcaagttccaagagttcagccccaactacatgggccttgagttccga
agaaaccaggactattacatcacctccacctccaacagcactctccagggcctggaaaac
cgagaggggggcgtgtgccagacacgatccatgaaaatcataatgaaggtcgggcaagat
cctaatgcagtgcctccagagcaactcacgaccacccgccctagcaaagaggctgataac
acagggaaaatcgcaacatttgggccgtggaatggtcctgtagaaaaccctggaaagtca
gacacaaacctgtctgataaacccacggcaggtgggggtgtggacggcttcttcaactcc
aaaattgccgtctttgcagcgattggagcaggatgtgtcatcttcatcctcatcatcatc
ttcctggtagtcctcttaattaagatccgcaaacgtcatcgtaaacacacgcagcagcgg
gcggccgccctgtccctaagcacactggccagccccaaatgcagcggcaatgcaggcagc
gaacccagtgacatcatcatcccgctgcggactacagagaacaattactgcccacactat
gagaaggtgagcggggactacggccaccctgtctacatcgtacaggagatgccgcctcaa
agccctgcaaacatttactacaaggtttga

DBGET integrated database retrieval system