KEGG   Xenopus laevis (African clawed frog): 394373
Entry
394373            CDS       T01010                                 

Gene name
gjb1.L, cmtx, cmtx1, connexin32, cx32, gjb1, gjb1-a
Definition
(RefSeq) gap junction protein beta 1 L homeolog
  KO
K07620  gap junction beta-1 protein
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xla02000]
    394373 (gjb1.L)
Transporters [BR:xla02000]
 Other transporters
  Pores ion channels [TC:1]
   394373 (gjb1.L)
SSDB
Motif
Pfam: Connexin Ninjurin
Other DBs
NCBI-GeneID: 394373
NCBI-ProteinID: NP_001095219
Xenbase: XB-GENE-865435
UniProt: P08983
Position
8L
AA seq 264 aa
MNWAGLYAILSGVNRHSTSIGRIWLSVVFIFRIMVLVAAAESVWGDEKSAFTCNTQQPGC
NSVCYDHFFPISHIRLWALQLIIVSTPALLVAMHVAHLQHQEKKELRLSRHVKDQELAEV
KKHKVKISGTLWWTYISSVFFRIIFEAAFMYIFYLIYPGYSMIRLLKCDAYPCPNTVDCF
VSRPTEKTIFTVFMLVASGVCIVLNVAEVFFLIAQACTRRARRHRDSGSISKEHQQNEMN
LLITGGSIIKRSAGQEKGDHCSTS
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaattgggcaggattatacgccatactgagtggcgtgaaccgccactccacctcaatc
ggacgcatatggctctctgtggtcttcatcttccgtatcatggtgcttgtggcggctgca
gaaagcgtatggggggatgagaagtccgcgtttacatgcaacacacaacagcccggttgc
aacagtgtatgctatgatcacttcttccccatctcacatatccgtctgtgggccctccag
ctcatcattgtatccacacctgcccttctggtggccatgcacgtggctcatctacagcac
caagagaagaaggagctacgtttgtcccgccatgttaaggaccaagagctggcagaagtg
aagaaacataaagtcaagatttccggcactttgtggtggacctacatctctagtgttttc
ttcagaatcatattcgaggcagcctttatgtacatcttctacctcatctaccctggttac
tccatgatccgacttcttaagtgcgatgcctatccctgccccaacactgtagactgtttc
gtttctcgtcccacggagaagaccatattcaccgtcttcatgctcgtcgcctctggagtc
tgcatcgttctgaatgttgctgaagtattcttcctgattgcccaggcctgcaccagaaga
gcccgccgccacagggattctggcagcatcagcaaagagcatcaacagaatgaaatgaac
ttgctgatcacgggaggaagtattattaaacggtctgcggggcaggagaaaggagatcac
tgttctacctcctaa

DBGET integrated database retrieval system