KEGG   Xenopus laevis (African clawed frog): 397748Help
Entry
397748            CDS       T01010                                 

Gene name
gsc.S, Xgsc, goosecoid, gsc, gsc-a, gsc-b
Definition
(RefSeq) goosecoid homeobox S homeolog
  KO
K09324  homeobox protein goosecoid
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xla03000]
    397748 (gsc.S)
Transcription factors [BR:xla03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    397748 (gsc.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 397748
NCBI-ProteinID: NP_001081278
Xenbase: XB-GENE-864870
UniProt: P53546
Position
8S
AA seq 243 aa AA seqDB search
MPSGMFSIDNILAARPRCKESLLLPQNGPLLFSSLGESLYGPADYSGFYNRTVAPTSALQ
GVNGSRLGYNNYYYGQLHLQTPVGPSCCGAVQALGTQQCSCVPSATAYDGAGSVLIPPVP
HQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQ
LARRVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKSSKNSAEKRDEQAKSDLD
SDS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccttctggcatgttcagcattgataacattttggctgccagacctcgctgcaaggag
tcgctgctgctcccccagaatgggccgttgctcttctccagtctgggggagtctctctat
ggccccgcagattacagcggattttataaccggactgtggccccaacttctgctctccaa
ggagtgaatggatctaggctgggatacaataactactactatggacagttgcatttacag
acgcccgtgggcccctcgtgttgtggagcagttcaagctctggggacgcagcagtgctcg
tgtgtaccctcagctacagcatacgatggtgcagggtcagtgctgattccaccagtgcct
caccagatgctcccttacatgaatgttggcactttgtccaggactgagctgcagttactt
aaccagctgcactgcaggaggaagaggaggcacaggaccatcttcaccgatgaacaactg
gaagcactggaaaatctcttccaagaaaccaagtacccagatgtgggcaccagagaacag
ctggcaaggagggttcatctcagagaggaaaaagtagaggtttggttcaaaaatcgaaga
gcaaaatggaggaggcagaaaagatcttcatcagaagaatcagaaaatgcccaaaagtgg
aataaatcctcaaaaaactctgcagagaaaagggacgagcaggctaaaagtgacctggac
tctgacagttga

DBGET integrated database retrieval system