KEGG   Xenopus laevis (African clawed frog): 397778
Entry
397778            CDS       T01010                                 

Gene name
tgfb1.L, TGF-beta5, ced, dpd1, lap, tgf-beta, tgfb, tgfb1, tgfb5, tgfbeta
Definition
(RefSeq) transforming growth factor beta 1 L homeolog
  KO
K13375  transforming growth factor beta-1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04060  Cytokine-cytokine receptor interaction
xla04068  FoxO signaling pathway
xla04110  Cell cycle
xla04218  Cellular senescence
xla04350  TGF-beta signaling pathway
xla04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397778 (tgfb1.L)
   04350 TGF-beta signaling pathway
    397778 (tgfb1.L)
   04068 FoxO signaling pathway
    397778 (tgfb1.L)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    397778 (tgfb1.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    397778 (tgfb1.L)
   04218 Cellular senescence
    397778 (tgfb1.L)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    397778 (tgfb1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xla03110]
    397778 (tgfb1.L)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xla04052]
    397778 (tgfb1.L)
   00536 Glycosaminoglycan binding proteins [BR:xla00536]
    397778 (tgfb1.L)
Chaperones and folding catalysts [BR:xla03110]
 Intramolecular chaperones
  Others
   397778 (tgfb1.L)
Cytokines and growth factors [BR:xla04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   397778 (tgfb1.L)
Glycosaminoglycan binding proteins [BR:xla00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   397778 (tgfb1.L)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 397778
NCBI-ProteinID: NP_001081330
Xenbase: XB-GENE-865765
UniProt: P16176 A0A1L8F936
Position
8L
AA seq 382 aa
MEVLWMLLVLLVLHLSSLAMSLSTCKAVDMEEVRKRRIEAIRGQILSKLKLDKTPDVDSE
KMTVPSEAIFLYNSTLEVIREKATREEEHVGHDQNIQDYYAKQVYRFESITELEDHEFKF
KFNASHVRENVGMNSLLHHAELRMYKKQTDKNMDQRMELFWKYQENGTTHSRYLESKYIT
PVTDDEWMSFDVTKTVNEWLKRAEENEQFGLQPACKCPTPQAKDIDIEGFPALRGDLASL
SSKENTKPYLMITSMPAERIDTVTSSRKKRGVGQEYCFGNNGPNCCVKPLYINFRKDLGW
KWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIY
YVGRTAKVEQLSNMVVRSCNCS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaggttctgtggatgctgctggtgctattggtcctgcatctttccagtttagctatg
tccttgtctacctgtaaggctgtggatatggaagaagtcaggaagaggagaattgaagcc
atcaggggccaaattctcagcaagctaaaactggacaaaacaccagatgtagacagcgag
aagatgacagtgcccagtgaagccatcttcctttacaatagcaccttggaggtgatcaga
gaaaaagcaaccagagaagaagaacatgtagggcatgatcagaacatacaggactattat
gcaaaacaagtttaccgatttgaaagcataaccgaactggaagaccatgaatttaagttt
aaatttaatgcttcgcatgtgagggagaatgtaggtatgaactctcttctgcaccatgct
gagctgcgcatgtacaagaagcagacagataaaaacatggatcaaaggatggaactattc
tggaaataccaggaaaatgggaccactcactcaagatacctggagagcaagtacattact
ccagtaacagatgatgagtggatgtcatttgatgttacaaagactgtgaatgaatggctg
aaacgtgcagaggaaaatgaacaattcgggttgcagcctgcctgcaaatgtcccacccca
caggccaaagatatagacatagaaggatttcctgctttacgtggagacttggcgagtttg
agttccaaagaaaacacgaaaccctacctgatgatcacttcgatgccagctgagcgtatt
gacacagttacaagctcacggaaaaagcgaggggttggacaggagtattgctttgggaac
aatgggccaaactgctgtgtgaaacctctttacataaattttcggaaggatctaggctgg
aagtggatccatgagcctaagggatatgaagcaaattattgtttaggaaattgtccttac
atctggagcatggatactcagtacagcaaggtgctatcactttataatcagaacaatccc
ggtgcatctatatctccctgctgtgttcctgatgtcttggagccactgccaatcatttat
tatgttggccgcactgctaaagtagagcagctctctaatatggtggtaaggtcttgcaac
tgcagctga

DBGET integrated database retrieval system