KEGG   Xenopus laevis (African clawed frog): 397925
Entry
397925            CDS       T01010                                 
Symbol
aurka.L, aik, ARK-1, ark1, aur-a, aura, aurka, aurka-a, aurora2, btak, Eg2, stk15, stk6, stk7
Name
(RefSeq) aurora kinase A-A
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04114  Oocyte meiosis
xla04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    397925 (aurka.L)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    397925 (aurka.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    397925 (aurka.L)
   01009 Protein phosphatases and associated proteins [BR:xla01009]
    397925 (aurka.L)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    397925 (aurka.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     397925 (aurka.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   397925 (aurka.L)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     397925 (aurka.L)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    397925 (aurka.L)
   Spindle formation proteins
    397925 (aurka.L)
  Sister chromatid separation proteins
   Aurora kinases
    397925 (aurka.L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal Seadorna_VP7 Kdo YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 397925
NCBI-ProteinID: NP_001081565
Xenbase: XB-GENE-866460
UniProt: Q91820 A0A1L8ESU8
Position
9_10L:complement(13470302..13482285)
AA seq 407 aa
MERAVKENHKPSNVKIFHPMTEGAKRIPVNQPQSTQFRPPGTAVSAQRILGPSNVPQRVL
AQAQKPILSSQKPTTQIPLRPATQGHQSSKPQGPNENRNPQQTSHSSTPNVEKKGSTDQG
KTSAVPKEEGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKSQLEKAG
VEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILDYAPGGELFRELQKCTRFDDQRS
AMYIKQLAEALLYCHSKKVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTL
DYLPPEMIEGRMHDETVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPPYVS
EEARDLVSKLLKHNPNHRLPLKGVLEHPWIIKNSQLKKKDEPLPGAQ
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggagcgggctgttaaggagaaccacaagccttctaatgtgaagatttttcaccccatg
actgagggagctaaacgtatcccagttaaccagccgcagagcactcagtttaggcctcct
gggactgcagtctctgcccagaggatattgggtccctctaatgtgccgcagcgagtgttg
gctcaggctcagaaacctattctgtccagtcagaagccaacgactcagatccccctgcgg
ccagcaactcaagggcatcagtccagcaaaccacagggaccaaatgagaatcgcaatcca
cagcagacaagccattcctccactccaaatgtggaaaagaaaggaagcaccgatcaagga
aaaacttcagctgttcccaaagaggagggcaaaaagaaacaatggtgcctggaagacttt
gaaatagggcggcccctgggcaaagggaagtttggaaatgtttatctggcacgcgagcgg
gagagtaaattcatcctggcgctgaaagtcctgtttaaatcccagctagagaaggcgggc
gtagagcaccagctacggcgggaggtggaaattcagtcccatctcaggcaccccaatatt
ctccggctctatggctatttccacgatgcttccagagtctacctaatcctggattatgcc
cctggtggggagttgttcagagagctgcagaaatgcacaagatttgatgatcagagaagt
gccatgtacatcaaacagctggcagaagccctcctgtactgtcactccaagaaggtgata
cacagggacatcaagccagagaacttgctgcttggctccaatggagaactgaagatcgcc
gactttggctggtctgtgcatgctccatcctccaggaggaccactctgtgtggaacactg
gactatctacctcctgagatgatcgagggcagaatgcatgatgagacggtggacttgtgg
agtctgggagttctctgttacgaattcctcgtagggaaacctccgtttgagactgacacc
caccaggaaacctacagacgtatttcaaaggttgaatttcaatatccgccatatgtatcg
gaagaggcaagagatcttgtctcaaagctgttaaagcacaacccaaaccacaggctgcca
ctgaaaggggttctcgaacatccatggatcataaaaaattctcaactcaagaagaaagac
gagccccttccaggcgcccaatag

DBGET integrated database retrieval system