KEGG   Xenopus laevis (African clawed frog): 397953
Entry
397953            CDS       T01010                                 

Gene name
grin1.S, NR1, grin1, nmda1, nmdar1
Definition
(RefSeq) glutamate receptor, ionotropic, N-methyl D-aspartate 1 S homeolog
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04020  Calcium signaling pathway
xla04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    397953 (grin1.S)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    397953 (grin1.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xla04040]
    397953 (grin1.S)
Ion channels [BR:xla04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   397953 (grin1.S)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Ion_trans_2 Peripla_BP_6
Other DBs
NCBI-GeneID: 397953
NCBI-ProteinID: NP_001081615
Xenbase: XB-GENE-866327
UniProt: A0A1L8F5J9
Structure
PDB: 

Position
8L
AA seq 904 aa
MGTMRLFLLAVLFLFSFARAGCDPKIVNIGAVLSTKKHEQIFREAVNQANKRHFTRKIQL
NATSVTHRPNAIQMALSVCEDLISSQVYAILVSHPPAPTDHLTPTPISYTAGFYRIPVIG
LTTRMSIYSDKSIHLSFLRTVPPYSHQALVWFEMMRLFNWNHVILIVSDDHEGRAAQKKL
ETLLEGKESKSKKRNYENLDQLSYDNKRGPKADKVLQFEPGTKNLTALLLEAKELEARVI
ILSASEDDATAVYKSAAMLDMTGAGYVWLVGEREISGSALRYAPDGIIGLQLINGKNESA
HISDAVAVVAQAIHELFEMENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYPDGVTGRIE
FNEDGDRKFANYSIMNLQNRKLVQVGIFNGSYIIQNDRKIIWPGGETERPQGYQMSTRLK
IVTIHQEPFVYVRPTTSDGTCREEYTINGDPIKKVICNGPNETIPGRPTVPQCCYGFCVD
LLIKLAREMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINN
ERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLD
RFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAM
IIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELST
MYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIG
MRKDSPWKQNVSLNILKSHENGFMEELDKTWVRYQECDSRSNAPATLTFENMAGVFMLVA
GGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQQYPPTDITGQLNLSDPSV
STVV
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgggcactatgcgccttttccttttggctgtactcttcttgttctcctttgcccgtgct
ggatgtgaccccaaaattgtgaacattggggcagtgctgagcaccaagaagcatgagcaa
atctttcgggaagctgtaaaccaggcaaataaacgccattttaccaggaagatccaactc
aatgccacctcggtaacccatcgacccaatgccatccagatggctctatctgtgtgtgag
gacctcatctccagccaggtctacgccatattggttagtcaccctcctgcccccacggat
cacctgacgccaacgcctatatcctacaccgcaggtttttaccggattccagtcattggg
ctgaccactcgcatgtctatctattctgataagagcatccacctctcgttcctacgcacg
gtgcccccgtactcccaccaggccttggtttggtttgaaatgatgcggctgttcaactgg
aaccatgtcattctcattgttagtgatgatcacgagggccgggccgctcagaagaagctg
gagaccctgttagaggggaaagagtccaagagtaaaaaaaggaactatgagaacctcgac
caactttcctatgacaacaagcgtggacccaaggcagacaaagtcctgcagtttgaacct
ggaaccaaaaatttgactgcccttctccttgaggccaaggaactggaagccagagttatc
atcctctctgccagtgaggatgatgccacagcggtgtacaaatcagcagcaatgctggac
atgactggtgctggctatgtctggttggtgggagagagggaaatatctggaagcgccttg
agatatgcgcctgatggaattattggactccagctcatcaatggaaagaatgaatcggcg
catataagtgacgcagtggctgtggtggctcaggcaatacacgaattgtttgaaatggaa
aatattactgaccctccgaggggctgtgttggaaacactaatatatggaagaccggacct
ctgttcaaaagggttctcatgtcttcaaaataccccgatggggtaacaggaagaattgag
ttcaatgaggacggagacaggaaatttgccaattacagtataatgaacctgcagaaccgc
aagttagtccaggttggaatcttcaatggcagctatattatacagaatgacagaaagatc
atttggcccggcggggagaccgagagaccacaaggctatcaaatgtccaccaggctgaag
atagttaccatccaccaagaaccttttgtatatgtgaggccaacaacatctgacggaaca
tgcagggaagaatacaccatcaatggtgatcccatcaaaaaagttatttgtaatggtccc
aatgagaccatcccaggtcgcccaactgtaccacagtgctgttatggcttttgtgtcgac
ctgctaattaaacttgccagagagatgaatttcacctatgaggttcacttggtagccgat
ggtaaatttggcactcaggagcgggtcaataacagcaataaaaaggagtggaacggcatg
atgggagagttactgagcggccaagcagacatgatcgtcgcaccactcactattaataat
gaacgtgctcagtacatcgagttttccaagccattcaagtatcaaggactcactatactt
gtgaaaaaggaaatcccgaggagcactctggactcattcatgcagccgtttcagagcact
ctctggcttctggttggactctcagtgcatgtggtggcggtgatgttatatctactggat
cgattcagtccgtttggacgtttcaaagtaaacagcgaagaggaagaggaagatgctttg
acactatcttcagccatgtggttttcctggggggtcctcttgaactctggtattggagaa
ggggctcccaggagtttttctgcccgaatccttggcatggtctgggctggattcgctatg
attattgtagcctcctatactgctaacctggctgccttcctggtcttggacaggccagag
gaaaggataactggcattaatgatccccggctgcgcaatcccagtgacaagtttatttac
gccactgtcaagcaaagctctgtggacatttatttccggagacaagtagaactcagcact
atgtacagacacatggaaaagcacaactatgagagtgcggcggaagccatacaagccgtg
cgcgataacaaactgcatgcttttatatgggactcggctgtgctggagtttgaggcctct
cagaagtgtgaccttgttaccaccggtgaattgttcttccgctctggcttcggcatcggc
atgagaaaagacagcccctggaaacagaatgtctcactaaacatcctcaagtcgcatgag
aacggcttcatggaagagctggataagacctgggtcaggtaccaggagtgtgactcccgc
agcaatgccccagccacattgacatttgagaacatggcaggggtcttcatgctggtcgct
gggggtattgttgccggaatcttcttgatatttattgaaatcgcctacaagcggcacaag
gatgcccgtaggaagcagatgcagttggcctttgctgccgtcaacgtgtggagaaaaaac
ctgcagcaatacccaccaaccgatatcacggggcaactaaatctgtccgacccttctgtt
agcactgtggtctaa

DBGET integrated database retrieval system