KEGG   Xenopus laevis (African clawed frog): 398131Help
Entry
398131            CDS       T01010                                 

Gene name
smurf1.L, smurf1
Definition
(RefSeq) SMAD specific E3 ubiquitin protein ligase 1 L homeolog
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04120  Ubiquitin mediated proteolysis
xla04144  Endocytosis
xla04340  Hedgehog signaling pathway
xla04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    398131 (smurf1.L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    398131 (smurf1.L)
   04350 TGF-beta signaling pathway
    398131 (smurf1.L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    398131 (smurf1.L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    398131 (smurf1.L)
   04121 Ubiquitin system [BR:xla04121]
    398131 (smurf1.L)
   03029 Mitochondrial biogenesis [BR:xla03029]
    398131 (smurf1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     398131 (smurf1.L)
Membrane trafficking [BR:xla04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    398131 (smurf1.L)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    398131 (smurf1.L)
Ubiquitin system [BR:xla04121]
 Ubiquitin ligases (E3)
  HECT type E3
   398131 (smurf1.L)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    398131 (smurf1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2 HPS3_N
Motif
Other DBs
NCBI-GeneID: 398131
NCBI-ProteinID: NP_001081939
Xenbase: XB-GENE-479050
UniProt: Q9PUN2
Position
9_10L
AA seq 731 aa AA seqDB search
MSNVVTRRGGSSIRVRLTVLCAKNLAKRDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKMDSITISIWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPTDNDAVRGQIVVSLQTRDRIGTLGSVVDCRGLLDNEGALLEDTGPGRPLSCFMDEPA
PYTDGPGAAGGGPGRLVESPGQEQRLQAQRVRGPEVREHVQTPQNRSHGFQSQDLPEGYE
QRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDDLGSLPAGWEVRTTVSGRIYFVDH
NNRTTQFTDPRLHHIINHQSQLKEPNHAIPVQSDGSLEDGDEFPAQRYERDLVQKLKVLR
HELSLLQPQAGHCRVEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYI
NGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITSVLDHTFCVEHNAFGRLL
QHELKPNGKNLQVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFEQK
ELELIIGGLDKIDISDWKANTRLKHCLANSNIVQWFWQAVESFDEERRARLLQFVTGSTR
VPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLT
AVEETSGFAVE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgttgtgactcggagaggtggatcgagtatcagagttcgtctgacagtttta
tgtgcaaagaacttggcaaagagggattttttcagattacctgatccatttgctaaaata
gttgtggatggatctggtcagtgccactcaacagacactgtaaagaacacattggatcca
aagtggaatcagcattatgacctgtatgttggtaaaatggattcaatcacaatcagtatc
tggaatcataagaaaattcacaagaaacagggagctggcttcctaggctgtgtgagacta
ttatccaatgccattagcagattgaaagacacaggctaccagcgcttggatctatgcaaa
ttaaaccccacagacaatgatgctgtgcggggccaaattgtagtcagtttacagacacga
gataggatcggtacactaggttctgttgttgattgcagaggactgctagacaatgaaggg
gcacttttagaagatactggccctggcaggccccttagttgtttcatggatgagccagca
ccttatactgatggaccaggtgcagctggaggaggacccggcaggctagtagaatctcca
ggtcaagaacagagactccaggcacagagagttcgtggaccagaagtcagagagcatgtc
cagacacctcaaaatcgatcccatgggttccagtcacaggacttgcctgaaggttatgaa
caaagaactacagttcaggggcaggtgtatttcttgcatacacaaacgggtgtcagcaca
tggcatgatccccgaataccaagagaccttaacagcgtgaattgtgatgaccttggctct
ctgcccgctggatgggaggtcagaaccactgtatctggaagaatatactttgtagatcac
aataatcgaacaacacagttcacagacccaagactacatcacatcataaatcatcagtcc
cagctaaaggagccaaatcatgctataccagtgcagagtgatggatctttagaagatgga
gatgagtttcctgctcagagatatgagagagacttggtacagaaacttaaagtcctgagg
catgagttatcattgctgcagcctcaagcagggcactgccgtgttgaagtgtcaagagaa
gaaatatttgaggagtcctatagacaaataatgaagatgagacccaaagatctgaagaaa
aggttgatggtgaaatttcgtggagaagaaggacttgattatggtggagttgccagggag
tggctgtatttactatgtcatgaaatgctgaatccatattatggactcttccagtattct
acagataatatttatactctgcaaattaatcctgattcatctattaatccagatcatttg
tcctatttccattttgttggtcgaattatgggattggctgtatttcatggacattacatt
aatggggggttcacagttcctttctacaagcaacttttggggaagcccattcagttgtct
gacctggaatctgtggatccagagttgcataaaagcctagtttggattttggagaatgac
attacttcagtattagaccacacattctgtgttgagcacaatgcatttggccgacttctc
cagcatgaattaaaaccaaatggcaagaacctgcaagtaacagaagagaacaagaaagag
tatgtgaggttgtatgttaattggaggttcatgagaggtatagaggctcagttcttagct
ctgcagaaaggttttaatgagctgataccacaacatctgttgaagccatttgagcaaaaa
gaactagagcttattatcggaggcttggataaaattgacatcagtgactggaaggcaaac
acaagattaaaacactgcttagctaatagcaatattgttcagtggttctggcaagcagtg
gagtcgtttgatgaggagagaagggccagactacttcagttcgtcacaggctctacacgt
gttcctcttcaaggctttaaagctcttcaaggttctacaggtgctgctggacccagactt
tttactattcatttgattgatgctaacacagataacctcccaaaggctcacacatgcttt
aaccgaattgacattcctccttatgaatcgtatgaaaagctctatgagaaattattaaca
gctgtagaagagactagtggttttgctgtggaataa

DBGET integrated database retrieval system