KEGG   Xenopus laevis (African clawed frog): 398216Help
Entry
398216            CDS       T01010                                 

Gene name
smo.S, XSmo, smo
Definition
(RefSeq) smoothened, frizzled class receptor S homeolog
  KO
K06226  smoothened
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04340  Hedgehog signaling pathway
Module
xla_M00678  Hedgehog signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    398216 (smo.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xla04030]
    398216 (smo.S)
G protein-coupled receptors [BR:xla04030]
 Frizzled / Smoothened family
  398216 (smo.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 398216
NCBI-ProteinID: NP_001082084
Xenbase: XB-GENE-17333650
UniProt: Q98SW5
Structure
PDB: 

Position
3S
AA seq 814 aa AA seqDB search
MSSMVPWICWIGGFGFLLFICTSGGVQINETFYMDKCKKTTTCEPLKYNICLGSVLPYAL
TSTVLAEDSSSQDEVHDKLSLWSGLRNAPRCWDAIRPLLCAVYMPKCEGGKVELPSQGLC
QTTRVPCAIVARERGWPDFLKCTTDYFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSWY
EDVEGCGIQCQNPLFTNKEHREMHIYIAIFSSVTIFCTFFTLATFLADWKNSNRYPAVIL
FYVNACFFVGSIGWLAQFMDGARDEIVCRGDGTMRLGEPTSNETLSCVIIFIIVYYSMMS
GVIWFVMLTYAWHTSFKALGTTHQPLSGKTSYFHLITWSIPFVLTVAILAVAQVDGDSVS
GICFVGYKNYHYRAGFVLAPIGLVLIGGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINE
TMLRLGIFGFLAFGFVLITFGCHFYDFFNQAEWERSFREYVLCEANVTIAEQTNKPIPEC
YIKNRPSLLVEKINLFAMFGTGISMSTWVWTKATIIIWKRAWCRILGRSDDEPKRIKKSK
MIAKAFSKRKELLNNPEKELSFSLHSVSHEGPVAGLNFDMNEPSADMSSAWAQHVTKMVA
RRGAILPQDVSVTPVATPVPPEERDQWFIEGDIPQGMVKKMSKKKKRRKKKEIQPLEAKT
VKEHFHSRANTAVPRLPKLPLKTGLVTRSKPQEVDETLPGSYREFRRLPNIQEKLYPVEG
VNNNLGYTRYPQSNMISHPFAADKMPLTDESRVAYVPVPKHDGVFQYSSANSYSNPMDLT
SYRGRTQPRWTENPPMHSRANLMDAELMDTDSDF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatggtgccttggatctgttggataggaggctttggctttttactcttcatt
tgtacttcaggaggagttcagattaatgagaccttttacatggataagtgcaagaagacc
accacttgtgagcccctcaaatacaacatttgcctgggatctgtgctcccctatgcattg
acttccactgtcctggctgaagattccagctcccaggatgaggttcatgataaactctcg
ctttggtctggattacggaatgctccacgttgttgggatgccatcaggcctctcctgtgt
gctgtctatatgccaaagtgtgaagggggcaaggtagagcttcccagccagggcctgtgc
cagacaacgcgggtcccatgtgcaatcgtagcacgagagagaggttggcctgatttcctg
aagtgcacaactgattatttccctgagggctgcccgaatgaagtacagaacataaagttc
aatagctctgggcagtgtgaggcaccgcttgtccgtactgacaatccaaagagctggtat
gaggatgtggagggctgcggcatccagtgtcagaacccactgttcactaacaaagagcat
cgtgagatgcacatctacattgccatattcagctcagtcaccatcttttgtacttttttt
actctggccaccttccttgcagactggaagaattccaaccgttacccagctgtcatcctg
ttttacgtaaatgcctgcttctttgtaggcagcataggttggcttgcacaatttatggat
ggtgcccgtgatgaaatagtttgtcgaggggatggtaccatgaggctaggggagcccaca
tccaacgagaccctttcatgtgtcattatctttataattgtgtattattccatgatgtcg
ggtgttatctggttcgtcatgctgacttatgcttggcacacctcttttaaggccctgggc
accacacatcagcccttgtctggaaagacttcctattttcacctgatcacctggtctata
ccttttgtcctcactgttgcaatacttgcagtggctcaggttgatggggattctgtaagc
ggcatctgctttgttggatacaagaattatcactacagagcaggttttgtactggctcct
attggacttgtgctaattgggggaggttattttttaatcagaggtgtaatgacattattt
tccatcaagagcaaccacccaggccttctcagtgaaaaagcggccagcaaaataaatgaa
actatgctgcggctgggaatatttggatttttggcctttggttttgtgctaatcacattt
ggctgccatttttatgacttcttcaatcaggctgagtgggaacggagttttcgggaatat
gttttatgtgaagccaatgtaactattgcagagcagaccaataagcctattccagaatgt
tatataaagaacagaccaagccttctagtggagaagatcaacctatttgctatgtttgga
actggcatatcaatgagcacctgggtctggacaaaggctactattatcatctggaaacga
gcatggtgccggattctagggagaagtgatgatgagccaaagaggatcaagaagagtaag
atgattgccaaggccttctccaagaggaaggagctgctgaataacccagagaaggaattg
tccttcagtctacacagtgtgtcgcatgaaggaccagttgctggtttgaattttgacatg
aatgagccatcagctgacatgtcatctgcatgggcacagcatgtcaccaaaatggtggct
agaagaggagccattttacctcaagatgtctcggtaacacctgtagcaactccagttcca
ccagaagaaagggaccagtggtttattgaaggagatatacctcaggggatggttaagaaa
atgtccaagaaaaagaaaaggcgaaagaaaaaagaaatccagcccctggaggcaaaaact
gtcaaggagcactttcacagtagggctaacacagcagtgcctcggcttcccaagctgcct
cttaagactggattggtcacaagatcaaaacctcaagaagtagatgaaactcttccaggg
tcttacagagaattcaggagattgcccaatatacaagaaaaattatatccagtagaaggt
gtgaacaacaacctgggatacacaagatacccacagtccaacatgatttcccatcctttc
gctgcagacaagatgccgcttacagatgaaagtagagtcgcgtatgtccctgtgccaaaa
catgatggagtgtttcagtattccagtgctaactcgtattctaatcctatggatctaact
tcatatagaggtagaactcagcctagatggacagaaaacccaccaatgcactctagagca
aaccttatggatgcagagctaatggatacagattctgatttttaa

DBGET integrated database retrieval system