KEGG   Xenopus laevis (African clawed frog): 398631Help
Entry
398631            CDS       T01010                                 

Definition
(RefSeq) glyoxylate reductase/hydroxypyruvate reductase-like protein
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00260  Glycine, serine and threonine metabolism
xla00620  Pyruvate metabolism
xla00630  Glyoxylate and dicarboxylate metabolism
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    398631
   00630 Glyoxylate and dicarboxylate metabolism
    398631
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    398631
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     398631
    1.1.1.81  hydroxypyruvate reductase
     398631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 398631
NCBI-ProteinID: NP_001165338
UniProt: A1L3E9
Position
Un
AA seq 356 aa AA seqDB search
MWSSCRFNILHKTLVARLNTCCRLQAMNTAGRNLPKVYITRRIPPDGLKALQQAGSCEIQ
QWDSDDPVPRSELLKKVSGIHALYCLLTEKIDKEVLDAAGPSLKVVSTMSVGYDHLSLDE
LKNRGIRVGFTPDVLTEAVAELTIALLLATSRRLIEAVEEAKNGGWGTWKPLWMCGSGLT
ESTVGIIGLGRIGEAIVNRLRPFGVKKFLYNDIAPREELAAKISVDFVSLEELAKQSDFL
LVCCALTPETQGMCNKGLFSKMKRSSVFINTSRGAVVNQEDLYHALANGQIASAGLDVTV
PEPLPTNHPLFKLKNCVILPHIASATVETRNAMAALAAHNLLAGLKGEAMPKELKL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtggagttcatgtcgttttaacatcctgcataagacattggtagcacggttaaacacc
tgttgtaggttacaagcaatgaatactgctgggagaaacttgccaaaggtttatatcacc
agacgaattcctccagatggtctgaaggcccttcagcaggctggaagctgcgagatacag
caatgggattcagatgatccagttccacgttctgaacttctcaaaaaggtctctggaatt
catgccttgtattgtcttttaacagagaagatagataaagaagtgctggatgctgcaggt
cctagcttgaaagttgttagcactatgtctgttggatacgaccacttatcacttgatgaa
ctaaaaaacagagggatccgggttggatttactccagatgttctaacagaagctgttgcc
gaactcacaattgcactactcctagcaacatcccgaaggcttattgaggctgtagaggaa
gcaaagaatggtggttggggtacatggaaacctctatggatgtgtggaagtggtctcaca
gaaagcactgttggaatcataggcctaggaagaattggtgaagctattgtcaatcgcttg
agaccatttggagtcaagaagttcctatacaatgatattgcacctagagaagaattagct
gccaagatctctgttgattttgtttccttggaagagttggcaaagcagtctgattttctc
cttgtgtgctgtgctctaactcctgaaactcaaggaatgtgcaacaaaggactcttctcc
aaaatgaaaagaagctctgtgtttataaatactagcaggggtgctgtagtaaatcaggaa
gatctttatcatgccttggcgaatgggcagatagcatctgctggtttagatgtcacagtc
ccagagcctcttcctacgaatcatccacttttcaaactaaaaaactgtgtcattctgcct
cacatcgccagtgcaactgtggaaacccggaatgccatggctgcccttgctgcccataat
ttattggccggcctaaaaggcgaggcaatgccaaaggaactgaaactttaa

DBGET integrated database retrieval system