KEGG   Xenopus laevis (African clawed frog): 398635Help
Entry
398635            CDS       T01010                                 

Gene name
pfn1.S, Profilin1, XProfilin1, profilin
Definition
(RefSeq) profilin 1 S homeolog
  KO
K05759  profilin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04810  Regulation of actin cytoskeleton
xla05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    398635 (pfn1.S)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    398635 (pfn1.S)
Membrane trafficking [BR:xla04131]
 Others
  Actin-binding proteins
   Others
    398635 (pfn1.S)
Cytoskeleton proteins [BR:xla04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     398635 (pfn1.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   398635 (pfn1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 398635
NCBI-ProteinID: NP_001082663
Xenbase: XB-GENE-17335499
UniProt: Q7SZB1
Position
5L
AA seq 137 aa AA seqDB search
MSWNGYIDNLTCEKVQEACICGYKGTPSVWACTPGGVFSNITPAEINALVSPNRESLFVN
GLTIGGVKCSVLRDEFAVVDNQVMDLRTKNPNGPTYNVSICKTEQALVMVMGKAEVHGGC
LNKKVFDMGKYLRCSGY
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggaacggctacatcgataacctgacgtgcgagaaagtgcaggaggcgtgtatc
tgcggctacaaggggaccccgtccgtatgggcctgcactcccggcggagtcttcagcaac
ataacgcctgctgagatcaatgcgttggtgtcgcccaaccgagagtcgctatttgtcaat
ggtctgaccataggcggagtcaagtgctccgtgctcagggacgagttcgctgtggtcgac
aaccaggtgatggatctgaggaccaagaaccccaacgggcccacctacaatgtctccatc
tgcaaaactgagcaagctctggtcatggtcatggggaaggccgaggtgcacggggggtgt
ctgaacaagaaagtctttgacatgggcaagtacctgagatgttctggctactga

DBGET integrated database retrieval system