KEGG   Xenopus laevis (African clawed frog): 398985Help
Entry
398985            CDS       T01010                                 

Gene name
mapk1.S, erk, erk2, ert1, mapk, mapk1, mapk1-a, mapk1-b, mapk1a, mapk2, mpk1, p42mapk, prkm1, prkm2, xp42
Definition
(RefSeq) mitogen-activated protein kinase 1 S homeolog
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04114  Oocyte meiosis
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04350  TGF-beta signaling pathway
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04520  Adherens junction
xla04540  Gap junction
xla04620  Toll-like receptor signaling pathway
xla04621  NOD-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04810  Regulation of actin cytoskeleton
xla04910  Insulin signaling pathway
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
xla04933  AGE-RAGE signaling pathway in diabetic complications
xla05132  Salmonella infection
Module
xla_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    398985 (mapk1.S)
   04012 ErbB signaling pathway
    398985 (mapk1.S)
   04350 TGF-beta signaling pathway
    398985 (mapk1.S)
   04370 VEGF signaling pathway
    398985 (mapk1.S)
   04371 Apelin signaling pathway
    398985 (mapk1.S)
   04068 FoxO signaling pathway
    398985 (mapk1.S)
   04150 mTOR signaling pathway
    398985 (mapk1.S)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    398985 (mapk1.S)
  Cell growth and death
   04114 Oocyte meiosis
    398985 (mapk1.S)
   04210 Apoptosis
    398985 (mapk1.S)
   04218 Cellular senescence
    398985 (mapk1.S)
  Cellular community - eukaryotes
   04510 Focal adhesion
    398985 (mapk1.S)
   04520 Adherens junction
    398985 (mapk1.S)
   04540 Gap junction
    398985 (mapk1.S)
  Cell motility
   04810 Regulation of actin cytoskeleton
    398985 (mapk1.S)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    398985 (mapk1.S)
   04621 NOD-like receptor signaling pathway
    398985 (mapk1.S)
   04625 C-type lectin receptor signaling pathway
    398985 (mapk1.S)
  Endocrine system
   04910 Insulin signaling pathway
    398985 (mapk1.S)
   04912 GnRH signaling pathway
    398985 (mapk1.S)
   04914 Progesterone-mediated oocyte maturation
    398985 (mapk1.S)
   04916 Melanogenesis
    398985 (mapk1.S)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    398985 (mapk1.S)
   04270 Vascular smooth muscle contraction
    398985 (mapk1.S)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    398985 (mapk1.S)
  Infectious diseases
   05132 Salmonella infection
    398985 (mapk1.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     398985 (mapk1.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   398985 (mapk1.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     398985 (mapk1.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   398985 (mapk1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 398985
NCBI-ProteinID: NP_001083548
Xenbase: XB-GENE-865273
UniProt: P26696 A0A1L8HQD8
Position
1S
AA seq 361 aa AA seqDB search
MAAAGAASNPGGGPEMVRGQAFDVGPRYINLAYIGEGAYGMVCSAHDNVNKVRVAIKKIS
PFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLK
TQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD
HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQL
NHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFN
PHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPG
Y
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcaggagctgcgtctaaccccggcgggggtccggagatggtgcggggccag
gcgttcgacgtaggccctcgatacatcaatctggcttatatcggcgagggagcgtacggc
atggtgtgttctgcccatgacaatgttaacaaagttcgagttgctatcaagaaaatcagc
ccatttgagcatcagacatactgccagcgaacattgcgggagatcaaaatcttgctacgt
tttaaacatgaaaacatcattgggataaacgacattattcgcgctccaaccattgagcag
atgaaagatgtgtacattgtgcaggacctcatggagacagacctctataagctcctgaag
actcagcatcttagcaatgaccatatctgctatttcttgtaccagattctgagaggatta
aagtacatccattcagccaatgttctacatcgtgatcttaagccttcaaatttgctgctt
aacactacctgtgatctcaagatctgtgattttggattggctcgtgttgcagacccagat
catgatcacactggctttctcacagaatatgtagccactcgctggtacagagctcctgag
atcatgctgaattccaagggctataccaaatcaattgacatctggtctgttggctgcatt
cttgctgagatgctttctaatagacccatatttcctgggaaacattatcttgaccagctt
aatcacatacttggtattcttggatctccatctcaagaggacctaaactgtataatcaat
ttaaaagctaggaattacttgctttcccttcctcacaaaaataaggtgccatggaacaga
cttttccccaatgcagatcccaaagctctagacttactggacaagatgctgactttcaac
ccccataaaagaattgaagtagaggcagctttggctcatccttatctggagcagtattat
gacccaagtgatgagcctgtagctgaagctccctttaaatttgaaatggagcttgatgat
ttgcccaaggagactcttaaggagctaatttttgaagaaaccgctagattccagccaggg
tactga

DBGET integrated database retrieval system