KEGG   Xenopus laevis (African clawed frog): 399095Help
Entry
399095            CDS       T01010                                 

Gene name
hs2st1.L, hs2st, hs2st1
Definition
(RefSeq) heparan sulfate 2-O-sulfotransferase 1 L homeolog
  KO
K02513  heparan sulfate 2-O-sulfotransferase HS2ST1 [EC:2.8.2.-]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    399095 (hs2st1.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xla01003]
    399095 (hs2st1.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     399095 (hs2st1.L)
Glycosyltransferases [BR:xla01003]
 Unclassified
  Sulfotransferases
   399095 (hs2st1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfotransfer_2 Gal-3-0_sulfotr Sulfotransfer_1 RAP
Motif
Other DBs
NCBI-GeneID: 399095
NCBI-ProteinID: NP_001083748
Xenbase: XB-GENE-5953205
UniProt: O93336 A0A1L8GMX0
Position
4L
AA seq 356 aa AA seqDB search
MGLLRIMMPPKLQLLAVLTFGVLMLFLENQIQNLEESREKLERAIARHEVREIEQRHSMD
GSRQEIALDDDEDILIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQD
QVRFVKNVSSWREMKPGFYHGHVSFLDFTKFGVKKKPIYINVIRDPIERLVSYYYFLRFG
DDYRPGLRRRKQGDKKTFDECVAAGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWALDQA
KYNLVNEYFLVGVTEELEDFIMLLEAALPRFFRGATELYRSGKKSHLRKTTEKKAPSKET
TAKLQQSDIWKMENEFYEFALEQFQFVRAHAVREKDGELYVLAPNFFYEKIYPKSN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggggctcttacggattatgatgccgcccaagttgcagctgctggcagtgctgaccttt
ggggtcttaatgcttttcctggagaaccaaatccagaacctagaggaatcacgggagaag
cttgaaagggcaatagcacgtcacgaagtacgggaaatagagcagcggcattccatggat
ggctcccgacaagaaattgcgcttgatgatgatgaagatattttaataatttacaacaga
gttccaaagactgccagcacttcctttacaaatattgcctatgatctgtgtgcaaaaaat
aaataccatgtgcttcatataaacacaaccaaaaataatccagttatgtctcttcaagat
caggtgcgctttgtgaagaatgtcagctcttggagagagatgaaaccaggcttctatcat
ggacatgtttcctttttggattttacaaaatttggcgttaaaaagaaacccatttacata
aatgtgattagagatcctatcgagagacttgtctcctattactatttcctgcgctttggt
gatgactatcgaccaggtttacggaggcgtaagcagggagataaaaagacctttgatgaa
tgtgtagcagctggaggctctgactgcgctccagagaaactttggcttcagatcccgttc
ttctgtggccacagctcagaatgctggaatgtggggagcagatgggctttggaccaagcc
aagtacaaccttgttaatgaatactttttagtcggagtcacagaggaacttgaagacttc
attatgttattagaagcagcattacccagattcttcaggggtgcaacagagctttaccgt
tcagggaagaaatcccatctcagaaaaacaacagaaaagaaagccccttcaaaggagaca
actgcaaaacttcagcagtctgacatatggaagatggagaatgagttctatgagtttgct
ctagagcagttccagtttgtcagagcacatgcagtacgagaaaaagacggagaactgtat
gttctagcaccgaactttttctatgaaaagatttacccaaagtcgaactaa

DBGET integrated database retrieval system