KEGG   Xenopus laevis (African clawed frog): 399172Help
Entry
399172            CDS       T01010                                 

Gene name
prkaa2.S, ampk, ampk2, prkaa, prkaa1, prkaa2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit S homeolog
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04910  Insulin signaling pathway
xla04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    399172 (prkaa2.S)
   04068 FoxO signaling pathway
    399172 (prkaa2.S)
   04150 mTOR signaling pathway
    399172 (prkaa2.S)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    399172 (prkaa2.S)
  Cellular community - eukaryotes
   04530 Tight junction
    399172 (prkaa2.S)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    399172 (prkaa2.S)
   04920 Adipocytokine signaling pathway
    399172 (prkaa2.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     399172 (prkaa2.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   399172 (prkaa2.S)
Membrane trafficking [BR:xla04131]
 Autophagy
  Other autophagy associated proteins
   Others
    399172 (prkaa2.S)
Mitochondrial biogenesis [BR:xla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    399172 (prkaa2.S)
  Mitophagy factors
   Other mitophagy factors
    399172 (prkaa2.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like Kdo RIO1 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 399172
NCBI-ProteinID: NP_001083882
Xenbase: XB-GENE-6486573
UniProt: Q8UVW8
Position
1S
AA seq 560 aa AA seqDB search
MRRLSSLMKMAADKQKHHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVAGGELFDYICKNG
KLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMADGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPPVISLLKHMLLVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSTNMID
DEALKEVCDKCECTEEEVLSCLYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FMEEPPISRPHPERVPFLIAESPRQRHTLDELNPQKTKHQVGVRRAKWHLGIRSQSRPND
IMAEVCRAMKQLGYEWKLVNPYYLRVRRKNPVTSMCTKMSLQLYQVDSRTYLLDFRSIDD
EVTESKSESATPRRSGSISNYRPPRNDSDPEIQAKSSDGSGPSSLTSSVDSSNADLLPRP
GSHTIEFFEMCANLIKILAR
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcagttcgctcatgaagatggcggcggataaacagaagcatcatgacggg
agggtgaagatcggtcactatattctgggcgacacgcttggggtgggcacgtttggcaaa
gtgaaagttggcaaacatgagctgacgggacacaaggttgcagtgaagattttaaaccgg
cagaagatccgcagcctcgatgtggttgggaaaattcgccgcgagatccagaacctgaag
ctcttccggcatcctcatattattaagctgtaccaggtcatcagcacgccaactgatatc
tttatggttatggaatatgttgctggcggggaactctttgattatatttgcaagaatggc
aagttggatgaaaaggaatcccggcgcttgttccagcaaattctttctggcgttgattat
tgccatagacatatggttgtacacagagacttgaagcctgagaatgttctcctcgatgcc
cacatgaatgcaaagattgcagattttgggctctctaacatgatggctgatggtgaattc
ctacgaactagctgtggctcccctaactatgctgcaccggaagttatttcaggaagactt
tatgctggcccagaggtggacatatggagctgcggggttatcctatacgctttactctgc
ggaactcttccgtttgatgatgatcacgtgccaacactttttaagaagatatgtgacggc
atcttctacacaccccagtacctgaatcctcccgtcattagccttctaaagcacatgcta
ttggtcgatcccatgaagagagcaacgattaaagatattcgggaacacgaatggttcaag
caagatcttcccaaatatctgtttcccgaggacccatcgtacagtacaaatatgatcgat
gacgaagccttaaaggaagtgtgtgataagtgtgagtgtacggaggaggaagtgctgagc
tgcttgtacagtcgcaaccaccaggatccattagccgtcgcctaccatctgatcatagat
aatcgcaggataatgaacgaggccaaagacttctatttggcaactagtcctccggattcc
ttcatggaagagcctcctatatcccggcctcacccagagagagtgccctttttaatagcg
gagtcgcctcggcaacggcacacactcgatgagttgaacccgcaaaagaccaaacaccaa
gttggtgtaagaagagccaaatggcatcttggcattcgaagtcagagccgaccaaatgat
attatggccgaggtttgccgagcaatgaaacaactgggctatgaatggaagcttgtgaat
ccttactacctgcgtgtgagaaggaagaacccagtgactagcatgtgcactaagatgagc
ctccagctgtaccaagtggatagcagaacttacctgctggatttccgcagcattgacgat
gaagttactgaatccaagtcggaaagcgccacccctaggagatcaggctccattagcaat
taccgacctccaagaaacgactcggatcctgaaattcaagcaaagtcttcagacggctca
gggccgtcctccttaacctcatcagtggactcttccaacgccgacttactccccaggcct
ggaagccataccatcgaattttttgaaatgtgcgcaaatctaataaaaatcctcgcacga
taa

DBGET integrated database retrieval system