KEGG   Xenopus laevis (African clawed frog): 399215Help
Entry
399215            CDS       T01010                                 

Gene name
ppp3r1.S, canb, ppp3r1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha S homeolog
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
xla04114  Oocyte meiosis
xla04218  Cellular senescence
xla04310  Wnt signaling pathway
xla04370  VEGF signaling pathway
xla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    399215 (ppp3r1.S)
   04310 Wnt signaling pathway
    399215 (ppp3r1.S)
   04370 VEGF signaling pathway
    399215 (ppp3r1.S)
   04020 Calcium signaling pathway
    399215 (ppp3r1.S)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    399215 (ppp3r1.S)
   04218 Cellular senescence
    399215 (ppp3r1.S)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    399215 (ppp3r1.S)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     399215 (ppp3r1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 399215
NCBI-ProteinID: NP_001083966
Xenbase: XB-GENE-948800
UniProt: Q7T063
Position
5S
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADRDGDGKISFEEFCVVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagcaagctatccattggaaatgtgctcacatttcgatgcggacgagatc
aaaaggctggggaaaaggttcaagaagctggatttagacaactccggttcgttgagtgtg
gaggagttcatgtcgttgccggagcttcagcagaaccctcttgtgcaacgagtaatagac
atatttgacacggatggaaacggagaagtagacttcaaagagtttatcgaaggagtgtcc
cagttcagtgtcaaaggtgataaggagcagaaactgaggtttgctttccgtatatacgac
atggacaaggacggctacatctccaatggtgagctcttccaggtactgaagatgatggtg
ggaaacaatctgaaagacacccagttacagcaaatagtagacaaaaccattatcaacgca
gatagagatggagatggaaaaatatcctttgaagaattctgtgttgtcgtaggaggttta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system