KEGG   Xenopus laevis (African clawed frog): 399255Help
Entry
399255            CDS       T01010                                 

Gene name
eif4e1b.S, eif4e, eif4e1b
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B S homeolog
  KO
K03259  translation initiation factor 4E
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03013  RNA transport
xla04150  mTOR signaling pathway
xla04910  Insulin signaling pathway
Module
xla_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    399255 (eif4e1b.S)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    399255 (eif4e1b.S)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    399255 (eif4e1b.S)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     399255 (eif4e1b.S)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     399255 (eif4e1b.S)
Translation factors [BR:xla03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    399255 (eif4e1b.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 399255
NCBI-ProteinID: NP_001084017
Xenbase: XB-GENE-6254191
UniProt: Q6AZE6
Position
1S
AA seq 231 aa AA seqDB search
MAAVEPENTNPQSTEEEKETGQEIENTNPQSTEEEKETGQEIVSPDQYIKHPLQNRWALW
FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEK
NKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEHSDDVCGAVVNVRAKGDKIAIW
TTEFENKDAVTHIGRVYKERLGLPAKVVIGYQSHADTATKSGSTTKNRFVV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggaaccggaaaacaccaatccccaatctacggaagaggaaaaagaaact
ggtcaggagattgaaaacaccaatccccaatctacggaagaggaaaaagaaactggtcag
gagattgtaagccccgatcagtacattaagcatccactacagaacagatgggccctttgg
ttcttcaaaaacgataaaagcaaaacttggcaggctaatctgcgcctcatttcaaaattt
gatacagttgaagatttttgggcgctttacaatcatatccagttgtctagtaacttaatg
tccggatgtgactattcactctttaaggatgggattgagcctatgtgggaagatgaaaag
aacaagcgtggaggtagatggctaatcacactaaacaaacagcagagaagaaatgattta
gatcgtttttggctagagacgctcatgtgccttattggagagtcctttgatgaacatagc
gacgatgtatgtggcgcagttgtaaatgttagagcaaaaggggataaaatagcaatctgg
actactgaatttgaaaacaaggatgctgttacacatatagggagggtttacaaagaaaga
ttaggacttcctgcaaaggtagtgattggttatcagtcccatgcagacacagctaccaag
agcggctccactactaaaaatcgatttgttgtttaa

DBGET integrated database retrieval system