KEGG   Xenopus laevis (African clawed frog): 399360
Entry
399360            CDS       T01010                                 

Gene name
celf1.L, brunol2, celf1-a, celf1-b, cug-bp, cug-bp1, cugbp, cugbp1, cugbp1-a, eden-bp, edenbp, nab50
Definition
(RefSeq) CUGBP, Elav-like family member 1 L homeolog
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xla03041]
    399360 (celf1.L)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    399360 (celf1.L)
SSDB
Motif
Pfam: RRM_1 RNA_bind RRM_7
Other DBs
NCBI-GeneID: 399360
NCBI-ProteinID: NP_001084196
Xenbase: XB-GENE-854043
UniProt: O57406
Position
4L
AA seq 489 aa
MNGTMDHPDHPDPDSIKMFVGQVPRSWSEKELRELFEQYGAVYEINVLRDRSQNPPQSKG
CCFITFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMVSKNCN
ENDIRAMFSPFGQIEECRILRGPDGMSRGCAFVTFTTRSMAQMAIKSMHQAQTMEGCSSP
IVVKFADTQKDKEQKRMTQQLQQQMQQLNAASMWGNLTGLNSLAPQYLALLQQTASSGNL
NSLSGLHPMGAEYGTGMTSGLNAIQLQNLAALAAAASAAQNTPSAGAALTSSSSPLSILT
SSGSSPSSNNSSINTMASLGALQTLAGATAGLNVNSLAGMAAFNGGLGSSLSNGTGSTME
ALSQAYSGIQQYAAAALPSLYNQSLLSQQGLGAAGSQKEGPEGANLFIYHLPQEFGDQDL
LQMFMPFGNVVSSKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLK
RSKNDSKPY
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaatggcacaatggaccacccagaccatccggatccggactccatcaagatgtttgtg
ggtcaggttcctcgaagctggtcagagaaagagctaagagaactcttcgagcagtacgga
gccgtctatgaaattaatgttctccgagacagaagccagaatcctcctcagagcaaagga
tgctgttttattactttctacacaagaaaagctgcgttagaagcacagaatgctttgcac
aacatgaaagttctccctgggatgcatcatccaatacagatgaagccagccgacagtgaa
aagaataatgctgtggaagaccgaaagctatttatcggaatggtttccaagaattgtaat
gagaatgatatccgggccatgttctctccgtttggacagatagaggaatgtcgtatcctg
cgaggccctgatggaatgagcagaggatgtgcattcgttacgtttacaactagatccatg
gcacagatggcaatcaaatccatgcaccaagcacaaaccatggagggctgttcctcacca
atagtggtaaagttcgcagacactcagaaagacaaagaacagaagcgcatgacgcagcaa
cttcagcagcaaatgcagcagctcaatgcagcctcaatgtggggtaacctgactggactg
aacagcttggcaccccagtatttagcactcctccagcagaccgcctcctctgggaacctc
aactccctaagtggtctccaccctatgggagctgagtacggcactggaatgacatcaggg
cttaatgccatacagttacagaatttggcagctttagcggctgctgctagtgctgcgcag
aacaccccaagtgcaggagcagcgctcacttcttccagcagccccctcagcatcctaacc
agttccggttcctcccccagttcaaataactcatccatcaacaccatggcatccctagga
gctctacagacattggctggggccacagctggtctcaatgtcaattcgcttgcaggtatg
gctgcgtttaatggaggcctaggcagcagtctctccaatggcactggcagtacgatggaa
gcccttagtcaagcttactctgggattcagcagtatgctgccgctgcacttccttcactc
tataaccagagccttttgtcacaacagggtttgggggctgcggggagtcagaaagaaggc
ccagaaggagccaacctttttatataccacctaccccaggagtttggggaccaggatctc
ctgcagatgttcatgccatttggaaatgttgtgtcctccaaagttttcatcgacaaacaa
acgaacctcagcaaatgttttggcttcgtaagttacgacaatcccgtttctgctcaggct
gctatccagtccatgaacggctttcagatcggaatgaaacgcctgaaagtccaactcaaa
cgctccaagaatgacagcaaaccctactga

DBGET integrated database retrieval system