KEGG   Xenopus laevis (African clawed frog): 403357Help
Entry
403357            CDS       T01010                                 

Gene name
acox1.S, aco, acox
Definition
(RefSeq) acyl-CoA oxidase 1, palmitoyl S homeolog
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00071  Fatty acid degradation
xla00410  beta-Alanine metabolism
xla00592  alpha-Linolenic acid metabolism
xla00640  Propanoate metabolism
xla01040  Biosynthesis of unsaturated fatty acids
xla01100  Metabolic pathways
xla01212  Fatty acid metabolism
xla03320  PPAR signaling pathway
xla04146  Peroxisome
Module
xla_M00087  beta-Oxidation
xla_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    403357 (acox1.S)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    403357 (acox1.S)
   00592 alpha-Linolenic acid metabolism
    403357 (acox1.S)
   01040 Biosynthesis of unsaturated fatty acids
    403357 (acox1.S)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    403357 (acox1.S)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    403357 (acox1.S)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    403357 (acox1.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     403357 (acox1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 403357
NCBI-ProteinID: NP_001084389
Xenbase: XB-GENE-17332128
UniProt: Q6P421
Position
9_10S
AA seq 661 aa AA seqDB search
MNPDLSRERAAASFNPETITYILDGSPERTHRRREIEGLVLNDPSFQHEDPNFLSRSERY
EVAIKKSALMVQKMREHGISDPEEIYWFKRTCLGSQTDPLGLHFSMFSNMLANQLTDLQK
QKWLPLASHLQVIGTYAQTELGHGTHLRGLETTATYDPSTQEFILNSPTVSSIKWWPGGL
GKTSNHAVVLAQLYTQGECKGLQAFIVPIRHMGTHEPLPGVVVGDIGPKFGYDETDNGFL
KFDKVRIPRENMLMKYAKVEPDGTYVKPLSDKLTYGTMVFIRSMIVGDSARSLSRACTIA
IRYSAVRHQSEIRAGEPEPQILDFQTQQFKLFPLLATAYAFQFVGSYMSHTYHRISAEIQ
AGNLNELPELHALSAGLKAFTSWAANAGIEECRMACGGHGYSRSSGIPDIYVTFTPSCTY
EGENTVMMLQTARFLVKSYIAVLAGKQLDGTVSYLNDVSQHRVQPHPVAGRSFLKDINDI
QNLVEAYKQRAAWLVVAAAKNVNADTKRGKRKEDAWNKNSVDLVRASEAHCHYVVVRLFA
EKLSEVLDVAAHRILSSLCLFYALHGISKNTGDFLQAGLLTALQVDQVQQRVKDLLAVIR
PNALALVDAFDYSDTQLGSVLGRYDGNVYENMFEWAKKSPLNKTQVHESFHKYLKPLQSK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagacttaagcagggagagggccgccgcctccttcaatcccgagaccatcacc
tacatcctggatggcagccccgagaggacccacaggaggagagaaattgagggcctggtt
ctcaatgaccccagcttccagcatgaagaccccaactttctgtcacgcagtgagcggtac
gaagtggccatcaagaagagtgccctgatggttcagaagatgagggaacatggcatctcc
gacccagaggagatctactggttcaaaagaacctgccttggctctcaaaccgaccccctg
ggcttacacttcagtatgttcagcaacatgttagccaatcaattgacggatttgcagaag
cagaagtggttgccccttgccagtcatctgcaggtcattggcacctatgcccagacagag
ctgggacatggaacccacctccgagggctggagaccacagctacctatgatccatccacc
caggagttcattctcaacagcccaactgtttcttctatcaaatggtggcctggaggattg
ggaaagacctcaaatcatgctgtagtgctggcacaactttacacacaaggagaatgtaaa
gggcttcaagcttttatagtgcctatccgccacatgggcacccatgaacctcttccaggt
gtggtggttggagacataggacctaagtttggatatgatgaaacagataatgggttcctt
aagtttgacaaagttcgaattcctcgagagaatatgctgatgaagtatgccaaggtggag
ccagatgggacttacgtgaagccactcagtgacaaactgacctatggcactatggtgttt
attcgttcgatgattgtgggagactctgcacgcagcctttcccgggcctgtaccattgct
attcggtatagtgcagtgaggcaccagtcagagatcagagctggagagccagaaccccaa
atcctagactttcagactcagcaattcaagttattcccactgctggctacagcatatgcc
ttccagtttgtgggatcctacatgagccacacttaccacagaatcagcgctgaaatccaa
gctggtaacctgaatgaactgcctgagctgcatgccctttctgcgggcttgaaagccttc
acatcatgggcagccaatgcaggtattgaggagtgcaggatggcatgtggtgggcatgga
tactcccgttccagtgggataccagatatctatgtgacctttactccttcatgcacatat
gagggtgaaaacacagtgatgatgctgcagactgcaaggtttttggtaaaaagctacata
gctgttcttgctgggaaacaacttgatggaacggtgtcatacctcaatgatgtttcccag
caccgtgtacagccccaccctgttgctggccgatcctttctcaaggacatcaatgacatt
caaaatctggtggaggcctacaaacagcgagctgcatggttagttgtggctgctgccaag
aatgtgaacgctgacacaaaacgtggaaagcgcaaggaagatgcatggaataagaattct
gtagatcttgtccgagcttcagaggcacactgtcattatgtggtcgtgagactctttgca
gaaaagttgtctgaggttctcgatgtggctgctcatcgtattctgagctctctctgcctg
ttctacgccctacatgggatcagcaagaacactggagacttccttcaggctggacttctg
accgcccttcaggttgatcaagtgcagcaaagagtaaaggatctgctagcagtaatccgt
cctaatgcactggctttggtggatgcctttgattactcagacacacaactgggatctgtt
ctgggtagatatgatggcaacgtctatgagaatatgtttgagtgggcaaagaaatcacca
ctcaacaaaacacaggtgcatgaatcctttcacaagtacttgaaacctttacagtccaaa
ctgtga

DBGET integrated database retrieval system