KEGG   Xenopus laevis (African clawed frog): 431841Help
Entry
431841            CDS       T01010                                 

Gene name
mok.L, mok, rage, rage-1, rage1
Definition
(RefSeq) MOK protein kinase L homeolog
  KO
K08830  renal tumor antigen [EC:2.7.11.22]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    431841 (mok.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     431841 (mok.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   431841 (mok.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo FTA2 Calmodulin_bind
Motif
Other DBs
NCBI-GeneID: 431841
NCBI-ProteinID: NP_001084801
Xenbase: XB-GENE-865781
UniProt: Q6NRS8
Position
8L
AA seq 411 aa AA seqDB search
MNRYKTISKIGEGTFSEVLKTQSLQDGNFYACKKMKQQFKSAEQVNNLREVQALRRLSPH
PNILTLCEVVFDRKSGCLSLICELMDMNIYELIRGRRHPLPENKLRHYMYQLCKSLEHIH
KNGIFHRDVKPENILIKQDVLKLGDFGSCRSLFSKQPYTEYISTRWYRAPECLLTDGYYT
YKMDIWSAGCVFFEIASLHPLFPGSNELDQISKIHDVIGTPDLALLKKFKPSRAMSFDFP
TKKGTGITRLLPNMSPDCLSLMCAMLEYDPDERLNASQSLQHSYFTEPRILERQHRKIRI
TEKSNTSGSMNYFLRIAGQGRRQALKTIAEPPTHYHAPAFPVELPKLNVPGVTKPLPKFR
SVFPTPGNNGKLPVLPSVKYFETKVNTTTLNPFFGNGGYMAGADSRKRFPF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacagatataaaacaattagcaaaataggtgaaggcactttttcagaggttttgaag
acacaaagtttacaagatggaaacttttatgcgtgcaaaaagatgaagcagcagtttaaa
agtgctgaacaggtgaacaatttgcgagaagtgcaagccctgaggcgactcagcccacat
ccaaacatcttaacattatgtgaagttgtctttgacagaaaatctggttgtctttccctg
atatgtgaacttatggatatgaatatctatgaattgatcagaggaagaagacacccattg
cctgaaaataagttgagacattacatgtaccagctatgcaagtccctggaacatatacat
aaaaatggaatctttcatcgagatgtgaaaccagaaaatattttaataaagcaagacgtc
ctcaaacttggtgattttgggtcatgtcgcagtttgttttccaaacagccttacacagaa
tatatttctacccgatggtatcgtgctccagagtgcctgcttacagatggatattatact
tacaaaatggacatttggagcgctggctgtgtattctttgaaattgctagtctgcacccc
ctgtttcctggatccaatgaattagaccagatctcaaaaattcacgatgttatcggcact
ccagatctagcattgctgaaaaaatttaaaccgtcacgggcaatgagttttgacttccct
acaaaaaaaggaacaggaataacccggctattacccaacatgtctcctgattgcttatcc
ttgatgtgtgcaatgttagaatatgatcctgatgaaaggcttaatgccagccaatctctt
cagcattcctatttcacagagcccagaatattagaaagacagcaccggaaaataagaata
acagaaaaatcaaacacttcaggatcaatgaactactttctgcggattgccggacaggga
cgcaggcaggcattgaagacaatagcagagcctcccacccattatcatgcacctgccttt
ccagtggagctgccaaaactaaatgtacctggagtaacaaagccgttgccaaagtttcgg
tcagtattccctacgcctggaaataatgggaaactcccagtactgccaagtgtgaagtac
tttgagaccaaggtaaacacaacaaccctcaaccctttctttggaaatggcggctacatg
gctggtgcagacagcaggaagagattccctttttaa

DBGET integrated database retrieval system