KEGG   Xenopus laevis (African clawed frog): 431925Help
Entry
431925            CDS       T01010                                 

Gene name
espl1.S, espl1
Definition
(RefSeq) extra spindle pole bodies like 1, separase S homeolog
  KO
K02365  separase [EC:3.4.22.49]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04110  Cell cycle
xla04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    431925 (espl1.S)
   04114 Oocyte meiosis
    431925 (espl1.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    431925 (espl1.S)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xla03036]
    431925 (espl1.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     431925 (espl1.S)
Peptidases [BR:xla01002]
 Cysteine Peptidases
  Family C50: separase family
   431925 (espl1.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    431925 (espl1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT TPR_12 Vac14_Fig4_bd
Motif
Other DBs
NCBI-GeneID: 431925
NCBI-ProteinID: XP_018105646
Xenbase: XB-GENE-1004364
UniProt: A0A1L8HA79
Position
2S
AA seq 2135 aa AA seqDB search
MEGNIKSLKGADFIKLTSSIEEVTLLHSKLKSCLSEGPAHSSSSDQLPDQRVVCDRVLRA
CNHWAGDPSCHESHWQSLVPLAALVCQGFCASSPQCTPFYLEKILFHLLKNISARESSFQ
ACSNLSDLLYGLLTGCPSEQQNAGDFTAVTKSSFQVLWKAAGDQEQKQNPNSCNREVLSL
RLHALRFLMLTEGSVSHGDAPLTISRHARCATFAFEPKGKPCSKEETCFLNQSLEDLLVK
PLLGRGTLSGSWSRCLVELTLERCRRLCKTSCFQQGRSVVEQASGCLEQTERCCHAGLAL
LNFAVDIHEFGIPPSIGKVLSEVTAIFDSACSSGYDWLCQALSECFQFAVSSLDGRFKHS
GMLTVDDILSLAKFFEKHHQLLEKQVTKVPKDESRQLKSLKQQQFNSLQQFTNAACAFMQ
NCKDKPKDGLLLLLGACRNAVSRMHSSLQGLPAQEAAEFLNITASCVHNLAYWFYSQKKY
VEASDLVSPLSAWLADGAPDSDPDLAVERLHRCYRLHVESCRKSGQIMKGLEAVGLWLRA
LRSKVSRHMAEPVALWVRLKMDGAKSGDEDIRLHTLKDGLVDRPVDSELMVSLLVEELQG
YKSVHGDTGQERYNTICDLLELCSEDSDLRGHRSTFLLELAQVLCYHDYSVQTDCSALDA
VQEALRLLDATSKLTEVDERLQDIKAQALLWQYICTLEANMREGLEEQKRKAKLESQNQW
TGVDYEPNDLNYEDKLHDDQSVRDGICFTLAGEAGPLKGLDEALDLWSSLLSCPQVPSLN
SAEQTIFSLHLLGSLYRLMGKPLQSIQAFQLAACLCHSLQDHIKEVGALCQLTKILFYLE
SPEYAQVTLQKAEEILKRADCTSENYTLAELSCQLLRSHLCRVTRQVKEGVELLLGLLQH
PSLQKSSKAWYLLKVQVLQELSLFLMLPSENVTSDLYKQLWAHGCHNPETALTEAHKLLR
SIVLLLLGNDVLSSPKGSSEVRFVDNGENLLQKWQVLADLLSCTQDLVKTLGRLGCVSEA
KSFCLEGLRIAKTLQSMRHCADFLMRKAELETLRSETLLCEEDLQYVLFLMESCTDFTTK
SEQKEVKIKLCKGKLLHKDEIIETPQSPPKDDFLKAVDLHYVETRDLLKAPESPTATSSL
EKNQPQFLSHTQDCTCALCSDLVLSLLCTQWLVAKAENDPQSRGLLISALKRCKALTRRF
SVIMQETLGKEIPKPAILGVAAELRARVYLAMASQSPSKLPEGILEEGLTFVSSHQATFH
KHWRAGLLLTKALCSIYNLAAKHGGCVADIFAQLWGWQPHQNSKKVSDLNHRNKTTSSIT
KKKTKKMSLDVPSSFPFEGSDMECPKLPPKPHTTPTQKNLPLNQARSVIATLPKKNTVTV
YNEESPVPEVLPRAPRRRKTRTVLKVDFNDSDLEVADNSEWEPLSNGRKQAIQTKSVGRG
RGRSRVAQGPLDSDDEDLTSKNKTRHKRPSTRRGQKESSPSGPMRRRRQVKIDVAPKEVD
VLRSIEEELEWVLDVSIEELRGSDTEKKKRTGRKGQKPAKNDGLVTECEVLRRDAGREYL
CWTPNFIGGETDPNPFSITGNSSSLPSTFSASDLSVVSSLLCEALESITHFPPSTLYSRL
CRLLALCRGKQDPYVTALLVSESVSITLRHQLLSDIHRKLRKIRRDGSGDVCDKFQCLTL
EDHKDAQVQHLSQLEEIFQFPKQALDIQRFQDQLQQIPANTAMCILTLVDSQTRMPGDTI
LLTRLVRGSPPVTVQIPTAHLKVSISSTLQEFDEIQKQQKAVNNLTDKKEWWEGRMELDC
RMKALIRLLEEQVLGCWKVLLSCPSSSEAVAEEFNRLSQALSDSCLGNTDPELLKVVLGG
SHFLTPSLIQSFIHGFGFSKPELAQELVQSAAGRLKESTEQSEGHLVLVLDKHLQKLPWE
SIPCLQKQSVTRLPSLHFLLSYGLLRKYQPQTTLVKGVDPKQTFYVLNPHANLPGTEERF
RDWFKNEPGWKGVIRSAPKSEMIQSALTKQDLYVYVGHGAGAHFLDVQTLQRLHCNAVVL
LFGCSSVALAVRGDLEGAGIVLKYLMAGCPLVLGNLWDVTDREIDRYTVAFLQSWLKEGS
GAPLLKFLSESRQAPKLKYIIGAAPVAYGLPVTLR
NT seq 6408 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaatataaagtccttgaagggagcagactttataaaactaacgtcttcgata
gaggaggtgactctgttgcactcaaagctcaagtcgtgtctctcagaaggccctgctcat
tcttcctcttctgatcagttaccagaccagcgggttgtttgtgatcgtgtgcttcgagcc
tgcaaccactgggcaggggatccaagttgtcatgagagtcattggcagagtttagtgccc
ctggcagccttggtatgccaaggtttctgtgcatcaagccctcaatgcacaccattctac
ctggagaaaattctgtttcacctgctgaagaacatctctgcacgtgaatcctcatttcag
gcttgtagtaatctgtcagatctcttgtatggacttctaaccggctgcccctccgagcag
cagaatgcaggagatttcacagctgtcacaaagagcagttttcaggttttgtggaaagcc
gcaggggaccaagaacaaaagcaaaatcctaactcttgcaacagagaagtcctgagcctt
agactgcatgcactgcgctttttaatgttgacggagggatctgtttcacatggggatgct
cctctaactatatcacgccatgcaagatgtgctacttttgcatttgagcccaagggcaaa
ccatgtagcaaagaagagacctgttttttaaaccagagtcttgaagatctccttgtgaag
cccctgttaggacgtggtactttgtctggttcatggtcccgctgcttggtggaactgaca
ctggagagatgccgtagactctgcaaaacttcctgtttccagcagggacgatctgttgtt
gaacaagcaagtggatgtttagaacagaccgagagatgctgccatgctgggttggcactt
ttaaactttgctgtggacattcatgaatttgggataccacctagtattggcaaagttctg
tctgaagtgactgcaatttttgacagcgcctgttcctctggttatgactggttatgtcag
gcactcagtgaatgtttccagtttgctgtttcttctttggatgggcgattcaagcattct
gggatgctaacggttgatgacattttgagccttgcaaagttctttgaaaagcatcatcag
cttctagaaaagcaagtgaccaaggttcctaaggatgagtcccgacaactgaaatcttta
aagcaacagcaattcaacagcttgcagcaattcacgaatgctgcatgtgcctttatgcag
aactgcaaggacaagcctaaggatggattgctattgctgcttggagcctgcagaaatgct
gtttcccggatgcacagttctcttcagggtctgcctgcccaagaagctgcagagttcttg
aacataacagcatcctgtgttcataacttggcctactggttctacagccagaagaaatat
gtagaagcctctgacctggtatctccccttagtgcatggcttgcagatggggctcctgat
agtgaccctgacctggcagtagaaaggttgcaccgctgttacagactgcatgtagagagc
tgcaggaagagtggccagattatgaagggccttgaagctgtgggtctttggctacgagct
ttgcgctctaaagtctctcggcatatggcagagccagtggccctatgggtgagacttaaa
atggatggtgctaagagtggagatgaagacataaggctgcatactcttaaagatggcctt
gtagatcgtccagtggactcagagctgatggtttcacttcttgtggaggaacttcaagga
tacaaatccgttcatggcgatacagggcaggaacgttacaatacaatctgtgatctcctt
gagctctgcagtgaggacagcgatcttagaggccaccgctccacatttcttttagagctg
gcccaggtcttgtgttaccatgactactccgtacagacagactgttctgccctggatgct
gtgcaggaagctcttagacttttggatgcaacttcaaaactcacagaagtggatgagcgt
ttgcaggacattaaagcccaagctctgctctggcagtatatctgtacccttgaagcaaat
atgagggagggtttggaggagcaaaagcgtaaggcaaagttagagagtcagaaccagtgg
acaggtgtggattatgagcccaacgacctgaactatgaagataaactgcatgatgaccag
tctgtcagagatgggatctgctttacattagcaggggaggcagggccgctgaaaggtcta
gatgaagctcttgatctgtggagtagtctcttgtcttgcccacaagtaccatctttaaac
agtgctgaacaaaccattttttcattgcacctgcttggatcattgtacagactgatggga
aaacctctgcaatctatacaggcctttcagcttgctgcctgtttgtgtcactctttacaa
gatcatattaaggaggttggggctctctgccagctcaccaaaatcttgttctacttagag
agtcccgagtatgctcaggttacccttcagaaggctgaggagatattaaaacgtgctgat
tgtaccagtgaaaattacactttggctgagttatcctgtcagcttttacgtagtcatctt
tgccgggtcacacgtcaggtcaaggaaggagtagaactgcttctgggtcttcttcagcac
ccttctctgcagaagtcatccaaagcctggtaccttctaaaagtacaagttcttcaagag
ctttcattatttctcatgctcccatcagaaaacgtaacctccgatctatacaagcagtta
tgggctcatggctgtcataatccagagacggctctgacagaagcccataaactgctaagg
agcatcgtcctcctccttcttggaaatgatgtgttgtcgtcccctaaaggctcttcagaa
gttcgttttgtggataatggagaaaaccttcttcaaaaatggcaagtccttgctgatctc
ctcagctgcacccaggatctagtcaagactcttggccgcttgggctgtgtttcagaagcc
aagtcattttgcctcgagggactccggatagccaaaactctgcaaagtatgaggcattgt
gcagatttccttatgagaaaagcagaactagagacactccgctcagaaactctgctctgt
gaggaagatttgcagtatgtgttgttcctaatggagtcttgtacagattttactaccaaa
agtgagcagaaagaggttaagataaagctttgcaaggggaaactgcttcataaagatgaa
attatagaaacgcctcagagtccaccaaaagacgattttctgaaagcagtagatcttcat
tatgtagaaacaagggatttgttaaaagcccctgaatctcctacagccacttcttcactg
gaaaagaaccaaccacagtttctgtcccatacacaggactgcacatgcgctctatgctct
gatcttgtattgtccttgctttgcacccagtggttggtggctaaggcagagaatgatcct
cagagcagaggtttgttaatatccgccctgaaaagatgcaaagccctaaccaggcgcttt
tctgtgattatgcaggaaacacttggtaaggaaatccccaaacctgcaattctaggagtg
gcagctgaacttagggctagagtgtacctggccatggcatcacagagtccctctaagctt
ccagaagggatactggaggaaggacttacctttgtgtcttcacaccaagcaacttttcat
aagcactggagagcaggccttctactgaccaaagctttgtgctctatatataatctggct
gctaagcatggaggttgtgttgcagatatttttgcgcaattatggggctggcagccacat
caaaacagcaaaaaagtatcagacctcaatcacaggaacaagacaacctctagcattaca
aagaaaaaaacaaagaaaatgtcactagatgtcccaagttcattcccttttgagggctct
gacatggagtgcccaaaattacctccaaaacctcacacaacgcccacccagaagaacctt
ccgttgaatcaagccagatcagttatagccactctcccaaagaaaaacactgtcacagtt
tacaatgaagaatcccctgtgcctgaagttcttccaagagcaccaagaaggcgcaaaaca
agaacagtgcttaaggttgattttaatgacagcgacttggaagtggcggataattctgaa
tgggagccgttatcaaacggcagaaaacaagctatacagacaaaatcagtaggcagaggt
cgtgggaggagtagggtggcacagggcccactcgactctgatgatgaagatctcacaagt
aagaataaaactaggcataaaagacccagcacaaggaggggccaaaaagaaagtagccca
tctgggccaatgcggaggcgccggcaagtgaaaattgatgtggctcctaaagaagtagat
gttctaagatccatagaagaagagcttgagtgggtgttggatgtcagcatcgaagagcta
aggggttctgatactgagaagaaaaaaagaactggtcggaagggtcagaagcctgctaag
aatgatgggttggtgacagaatgtgaagtgctgagaagagatgccggaagagaatatctg
tgttggaccccaaatttcataggaggagaaacagacccaaacccatttagtatcaccggg
aattcatcttctctcccttctactttcagtgcctctgacctgagtgtggtctcctcactt
ctgtgtgaggctctggagtccataactcactttccaccaagtaccctctattccaggctg
tgccgccttcttgcattgtgcagaggaaaacaagatccgtatgtcacagctcttctagtt
agcgagtctgtttccattacattgaggcaccaattgctaagtgacattcaccggaaatta
cggaaaatacggagagatggctcaggagatgtgtgtgacaagtttcagtgtctgactctg
gaagatcataaagatgcccaggttcagcacctctctcagctagaggagatcttccagttc
ccaaaacaagctctagacatacaaaggttccaggaccaactccagcagatccctgcaaat
acagcaatgtgcatattgaccttggtggactcgcagacaagaatgcctggtgatactata
ctgctcaccagacttgttcgaggaagcccccctgtcacagtccagattcctactgctcat
ttgaaggtgtccataagctctacattacaagaatttgatgaaatccaaaagcagcagaag
gctgtcaacaacttgacagacaaaaaggagtggtgggaagggcgcatggagttggattgc
agaatgaaggctttaatacgtctactagaagagcaggttttgggctgctggaaagtattg
ctaagctgcccaagctccagtgaagctgttgcagaagaattcaacaggctgtcacaggca
ctatcagattcttgcttgggaaataccgatcctgaacttctgaaggttgtgctgggtggc
agccacttcctaaccccttctcttattcagtcctttatccacgggttcggcttttcaaag
cctgagctggctcaggagcttgtacaaagtgccgcagggagacttaaagagagcacagaa
caatctgaaggacacctggtgcttgtgctagataagcatctccaaaagcttccatgggag
agcattccctgccttcagaagcagtccgtcacacggcttccatctctacacttccttctc
agctatgggttgctcaggaagtaccaaccacagacaactcttgtcaagggagttgaccca
aagcaaacattttatgtccttaaccctcacgcaaacctacccggcactgaggagcgcttc
agggactggttcaaaaatgaacctgggtggaagggagtaatccggtctgctccaaaatct
gaaatgattcagtctgcactgacaaagcaagatctctatgtctatgtgggacatggtgca
ggggcacacttcttggatgttcagacactccagaggttacactgcaatgctgtggttttg
ctctttgggtgtagcagtgttgcccttgcagttcggggagatctggaaggtgcaggaatt
gttttaaaataccttatggctggatgccctttagttctcggcaacttatgggacgtcaca
gatcgtgagattgaccgctataccgtagcatttctacaaagttggctcaaggaaggatcc
ggagcacctcttttgaaattcctctctgaatcccgccaagctcccaagttgaagtacatc
attggtgcagctcctgtagcttatggcttgccagtgaccctgcgatag

DBGET integrated database retrieval system