KEGG   Xenopus laevis (African clawed frog): 432058Help
Entry
432058            CDS       T01010                                 

Gene name
pgam1.L, pgam1
Definition
(RefSeq) phosphoglycerate mutase 1 L homeolog
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00010  Glycolysis / Gluconeogenesis
xla00260  Glycine, serine and threonine metabolism
xla01100  Metabolic pathways
xla01200  Carbon metabolism
xla01230  Biosynthesis of amino acids
Module
xla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xla_M00002  Glycolysis, core module involving three-carbon compounds
xla_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    432058 (pgam1.L)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    432058 (pgam1.L)
Enzymes [BR:xla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     432058 (pgam1.L)
Membrane trafficking [BR:xla04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    432058 (pgam1.L)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   432058 (pgam1.L)
  Exosomal proteins of melanoma cells
   432058 (pgam1.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 432058
NCBI-ProteinID: NP_001084996
Xenbase: XB-GENE-1007747
UniProt: Q6IRQ8
Position
7L
AA seq 254 aa AA seqDB search
MAAYKIVLIRHGESSWNQENRFCGWFDADLSETGQQEAQRGGQALKDAGFEFDICFTSVL
KRAIRTLWIALEGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKVWRRSFD
IPPPPMDPDHDYYSIISKDRRYADLTEEQLPSCESLKDTIARALPFWNEEIVPLIKQGKR
VFIAAHGNSLRGIVKHIEGMSDEEIMGLNLPTGIPIVYELDKNLKPTKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcttacaaaattgtacttatccgccacggagagagctcttggaaccaagaaaat
cgcttctgcggatggtttgatgcggatcttagcgaaaccggccagcaagaagcccagaga
ggcggccaagctctcaaagatgctggctttgagtttgatatctgcttcacgtctgtgctt
aagcgggccattcgtacattatggatagctttggagggcatcgaccagatgtggctacca
gttgtcagaacatggcgactgaatgagaggcattatggtggcctaacaggccttaataag
gcggagactgctgctaagcatggagaagagcaggtcaaggtttggagaagatcatttgat
attcctccacctccaatggatccagatcatgattattatagcataatcagcaaggatcga
cgctacgcagacctgacagaggagcagcttccaagttgtgaaagcttgaaggataccatt
gcacgtgccctacccttctggaacgaggagattgtcccacttattaagcaggggaaacga
gtgtttattgcagctcatggcaacagtcttaggggaattgtcaagcacattgaaggtatg
tcagatgaagagatcatgggactaaacttgcccactggaatccctattgtttatgaactg
gacaagaacctgaaacctactaaaccaatgcagttcctgggagatgaagagactgtgcgg
aaggccatggaggctgtagctgcccaaggcaaagccaagaagtaa

DBGET integrated database retrieval system