KEGG   Xenopus laevis (African clawed frog): 432084Help
Entry
432084            CDS       T01010                                 

Gene name
mapkapk2.L, mapkapk2, mapkapk2.S
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2 L homeolog
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04218  Cellular senescence
xla04370  VEGF signaling pathway
xla04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    432084 (mapkapk2.L)
   04370 VEGF signaling pathway
    432084 (mapkapk2.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    432084 (mapkapk2.L)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    432084 (mapkapk2.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xla01001]
    432084 (mapkapk2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     432084 (mapkapk2.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   432084 (mapkapk2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like MAM1
Motif
Other DBs
NCBI-GeneID: 432084
NCBI-ProteinID: NP_001085020
Xenbase: XB-GENE-5896952
UniProt: Q6IRB4
Position
2L
AA seq 377 aa AA seqDB search
MMNPGIPFPNLPALNQTPVQQQQQQQQLKSSLQIKKNAITDDYKVTNQVLGLGINGKVLE
IFSKKTGEKFALKMLQDCPKARREVDLHWRASQCAHIVKIIDVYENLYQSRKCLLIIMEC
LDGGELFSRIQDRGDQAFTEREASEIMRSIGEAIQYLHSINIAHRDVKPENLLYTSKRPN
YVLKLTDFGFAKETTTHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGY
PPFYSNHGFAISPGMKKRIRMGQYEFPNPEWSEVSDEVKQLIRNLLKTEPTQRMTITEFM
NHPWITQSMQIPPTPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQIKIKKIEDASN
PLLQKRRKKITPHVATH
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccctggcatcccatttcccaaccttccagccctaaaccagaccccagtacaa
caacaacaacaacagcagcagctgaagtcttctcttcaaatcaaaaagaacgccataact
gatgactacaaagttactaatcaggtcttgggactggggatcaatggaaaggtactagag
atcttcagtaagaagactggagagaagttcgctttgaagatgttacaggactgcccaaag
gcgcgtagggaggtggatctgcactggagggcctcccagtgtgctcatattgtgaagatt
attgatgtgtatgaaaacctttaccagtccagaaagtgtctcctcattattatggaatgt
ctggatggtggagagctctttagcagaattcaggacagaggggaccaagccttcaccgag
agggaggcatcagagatcatgagaagcattggagaagcaatccaatacttacactctatt
aatattgcacacagagatgtaaagccagaaaatctcctatatacatcgaaacggccaaac
tatgtgttaaagttgactgattttggatttgctaaggaaaccacaacacacaattcacta
gcaacaccatgctacacaccttattatgttgctcctgaagttctcgggccagaaaaatac
gacaagtcgtgtgatatgtggtctcttggtgttatcatgtacattctattgtgcggttat
ccaccattttactccaaccatggttttgccatctcccccggaatgaagaaacggatccgc
atggggcagtatgaatttccgaacccagagtggtctgaggtttcggatgaagtaaagcag
ctgatcagaaatcttttgaagactgaaccaacgcagaggatgacgatcacagaatttatg
aaccatccttggataacgcagtctatgcagattccaccaacacctcttcataccagcagg
gtcttaaaagaagagaaggatttgtgggaagatgttaaggaagagatgacaagtgccctt
gccaccatgagagttgactatgagcagataaagataaagaagattgaagatgcctctaat
cctctcctccaaaagagacgaaagaagatcactcctcatgtagcaactcactga

DBGET integrated database retrieval system