KEGG   Xenopus laevis (African clawed frog): 443569
Entry
443569            CDS       T01010                                 
Symbol
pals1.L, mpp5, mpp5.L
Name
(RefSeq) protein associated with LIN7 1, MAGUK family member L homeolog
  KO
K06091  MAGUK p55 subfamily member 5
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    443569 (pals1.L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:xla04990]
    443569 (pals1.L)
Domain-containing proteins not elsewhere classified [BR:xla04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   443569 (pals1.L)
SSDB
Motif
Pfam: Guanylate_kin L27_N PDZ SH3_2 PDZ_6 L27 SH3_1 PDZ_2 SH3_9 Peptidase_M50
Other DBs
NCBI-GeneID: 443569
NCBI-ProteinID: NP_001085267
Xenbase: XB-GENE-978293
UniProt: Q4KLW9
Position
8L:complement(112652426..112685297)
AA seq 675 aa
MTTSHVNGHVTEDSDSDKQSSDLAAQEELPKHREMAVDCPGDLGSRAMPIRRSAQLERIR
QQQEDMRRRREEEGKKQELDVNSSMRLKKLAQIFPKTGIDNPIFDTDEVLVLESPSRAVK
VLEIEDLLSSLKDIQHTLVDSQSQEDIGLLFQLVQNVDFQNAFKIHNAVAVHMNKVSPPY
PLVPNAQDLTQEVQQVLKSSHQKESQELSVLLNTPHIQALLLAHDKVAEQEMMPEPSSED
CFYENIGLYGDETVKIVRIDKARDIPLGATVRNDGDSVIISRIVKGGAAEKSGLLHEGDE
ILQINGTEIRGKDVNEVFELLADMHGNLSFLLIPSQQSKSLSTKESVVHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQSCGQNELRQRLMANEPDRFAAAVPHTTRSRRENEVSGRDYHFVSRQTFDADI
SSGKFIESGEFEKNLYGTSVDSVRQVINSGKICLLCLHTQSLKMLRNSDLKPYIIFIAPP
SQERLRALLAKDGRNPKPEELREIIEKAREMEQNNGHYFDTAIVNTDLDKAYQELIRLIN
KLDTEPQWVPSSWLR
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgaccacttctcatgtaaacggacatgtaacagaagactctgacagtgacaagcagagc
tcagatctcgccgctcaagaggagctacccaaacacagggaaatggccgtcgattgtccc
ggggacttaggttcgagggcgatgcccatccgacggagcgcccaactagaacgcatccgg
cagcagcaggaggacatgaggcgcaggcgggaggaggaagggaagaaacaagagctggat
gttaattcatctatgaggcttaaaaagttggcacagattttccctaaaactggaattgac
aaccctatttttgatactgatgaagtgctggtgttggaaagtcctagccgggctgtgaaa
gtactggagattgaagacttgttatcgtcgctcaaggatatccagcacaccttggtagac
tctcagagccaggaagatattggcttacttttccaactggtgcaaaatgtggactttcag
aacgccttcaagatccacaatgctgtggccgtgcacatgaacaaagtcagccccccgtac
ccgctcgttcctaacgcacaagatctaacacaagaggtacagcaagtgttaaagtccagc
catcagaaggaaagtcaggagcttagtgtcttgctaaacacccctcacattcaggctctt
cttctggcccatgacaaggttgcggagcaggagatgatgcctgagccctcatcagaagat
tgcttttacgagaacattgggctatatggagacgagaccgtaaaaattgtccgaatagac
aaagccagagatatcccattgggggccactgtgcggaatgatggggattctgtcattatc
agccggatagtcaagggtggggcagcggaaaagagcggcttgttacacgaaggggatgaa
atccttcaaataaatggcaccgagatccgagggaaagatgtgaacgaggtgtttgaactg
ctggctgatatgcatggcaacttgtcatttctgctgattcccagccaacagtccaagtca
ctgtccactaaagaatctgtggtacatgtaaaggctcactttgactacgacccatctgac
gacccttatgtgccatgcagagagctaggcctatccttccagaaaggagacatcctccat
gttattagtcaggaggaccccaactggtggcaggcttatcgggatggtgatgaagacaac
cagcctttggcaggacttgtacctggaaagagcttccagcagcagagagaagctatgaaa
caaacgatagaagaagacaaagaaccagaaaaatcggggaaattgtggtgtgcaaagaaa
aataagaagaaaaggaagaaggttctgtacaacgccaataaaaatgatgattatgataat
gaagaaatcctgacgtacgaggagatgtccctttatcatcagccggcgaacagaaagcgg
ccaatcattctcattgggccccagagttgtgggcagaatgagctacggcaaagactcatg
gcaaacgaaccagacagatttgctgccgccgtacctcataccactcggagcaggagggag
aatgaagtgtcagggcgtgactatcactttgtgtcgcggcagacttttgatgcggacatt
tcttctgggaagttcattgagtctggggagtttgagaaaaacctatatggcaccagcgtg
gactctgtacggcaagtcatcaactccggcaaaatctgcctcttgtgtctgcacacgcag
tccctaaaaatgctccgtaattctgatttaaagccatatattatattcattgcgccacct
tctcaagaaaggctgagggcattattggccaaggatggcaggaatcccaagccagaagag
ctgagagagatcattgagaaagccagagaaatggagcagaacaacggccattactttgat
acagcaattgtaaatacagacttagacaaggcttatcaggaactgattcggctgatcaac
aaactggacacggagcctcagtgggtcccttcttcgtggctgcggtga

DBGET integrated database retrieval system