KEGG   Xenopus laevis (African clawed frog): 443597Help
Entry
443597            CDS       T01010                                 

Gene name
dock7.S, dock6, dock7, dock7.L, zir1, zir2
Definition
(RefSeq) dedicator of cytokinesis 7 S homeolog
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xla04131]
    443597 (dock7.S)
Membrane trafficking [BR:xla04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    443597 (dock7.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 443597
NCBI-ProteinID: XP_018115332
Xenbase: XB-GENE-998182
Position
4S
AA seq 2105 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGSPQPHKNLSTGGGSSHHASVPLTEVVDPVDFE
DYLITHPVSLDSGPLRDLYEFPADDVEVLYVQRECRTMVSSVPEESEMDSHVKDCIRSYT
EDWAIVNRKYHKLGTGFNPNTLDKQKERQRGLPKQVFESDEVSESSSYQDDQDDIKRRSM
SIDDTPRGSWACSIFDLKNSASDALVPNLLDRAPNEEIDHQNEDQRKSSRHKELFALHPA
QDEDEPIERLSVPEVPKEHFGQRLLVKCISLKFEIEIEPIFASLALYDIKEKKKISENFY
FDLNSEQVKGMLRPYVSSPAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEP
YMIYKEADTAKNKDKLEKLKSQADQFCQRLGRYRMPFAWTAIHLMNIVSSAGSLERDSTE
VEIGPAERKGSWSERRNSSIVGRRSLERTTSGDESCNLTAFRPATLTVTNFFKQEGDRLS
DEDLYKFLADMKRPSSVLRRLRPITAQLKIDISPAPENPNYCLTPELLQVKPYPDSRVRP
TREILEFPARDVYVPDTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMSGEDPNNAMAV
ICGKSSSPEFSKEAYTTVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQNT
PLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFN
VEVVAVSTVHTQVSTFKANYPEYELKSSISALSSAQLEPVVQFLHLLLDKLILLVVRPPI
IAGQIVNLGQASFEAIASITNRLYKNLEGNHDQHGRNNLLASYIHYVFRLPNTDPNSPSP
GPGGLGGSMHYATMARSVNRPASLNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKGLD
RSNSWVNTGGPKGAQWGTNPSPSAETVQAMDRCNRMSSHTETSSFLQTLTGRLPTKKLFH
EELALQWVVCSGTVREAALQQAWFFFELMVKSMVQHLYFADKLDCPRKHRFPERFMDDIA
ALISTMANDIVTRFQKDTEMVERLNVSLAFFLNDLLSVMDRGFVFVLIKAYFKQVSSKLY
LQPNPSILVSLRLDFLRIICSHEHYVTLNLPCSLLTPPSSPSPSVSSATSQSSAFSTNVL
DQKIANMFELSVPFRQQHYLAGLVLTELAVILDPDAEGLFGLHKKVINMVHNLLSTHDSD
PRYADAEVKARVATLYLPLIGIVMETVPQLYDFTESHNQRGRPNCTTADDHDGDGGSMIS
QSVAMAIAGTSVPQLTRPNSFLLTSTASRQHTTFSAESSRSLLICLLWVLKNADETVLQK
WFTDLSILQLNRLLDLLYLCVSCFEYKGKKTFERMNSLTFKKSKDMRAKLEEAILGSIGA
RQEMVRRSRGQLERSPSGSAFGSQENLRWRKEMTHWRQNTDKTDKSRAELEHEALIDGNL
ATEANLIILDTLEIIVQTISLTESKESILGGVLKTLLHSMACNQSSLYLQHCFATQRALV
SKFPELLFEEETEQCADLCLRLLRHCSSSISNIRSHAGASLYLLMRQNFEIGNNFARVKM
QVTMSLSSLVGRSQNFNEEFLRRSLKTILTYAEEDLELRETTFPEQVQDLVFNLHMILSD
TVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERINHAESAQCLVHSA
ALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLV
GLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFSKVVHQSTGW
ERMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVLEVIKD
SNPVDKCKLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHG
ELHEQFKRKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDP
ADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDA
LRKNKSLIGPDQKEYQRELERNYHRLKESLQPLINRKIPQLYKTVLPVTCHRDSFSRMSL
RKMDL
NT seq 6318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgcgcatttgcacagaagattagcagaacagtggctgcagaggtacga
aaacaaatatctggacaatatggttctccacagccccacaaaaacctaagcactggagga
ggaagctcacatcatgcttcggttcctcttacagaagtggttgacccagttgattttgag
gactatctcattactcatccagtgtctttagactcaggtccattaagagacctgtatgag
tttcctgctgacgatgttgaagttctctatgttcagagagaatgcaggactatggtgtct
tcagtaccagaagaaagtgaaatggattctcatgtcaaggattgcataagaagttacaca
gaagactgggcaattgtaaatagaaaataccacaaattaggaactggctttaaccctaac
acactggacaagcaaaaagagagacaaaggggtttgccaaagcaagtttttgaatctgac
gaggtttctgagagcagcagctaccaggatgaccaagatgacatcaaaagacgctcaatg
tccatagatgatactccacggggaagctgggcttgcagcatatttgatctcaaaaactct
gcatctgatgctcttgtacctaacttacttgatcgtgctccaaatgaagaaattgatcac
caaaatgaagaccaaaggaaatcaagcagacacaaagaactctttgcattgcatcctgct
caggatgaggatgaacccattgaacggttgagtgttcctgaggtaccaaaggaacacttt
ggacagagactgctggtaaaatgcatatccctaaaatttgaaatagaaatcgaaccgatt
tttgcaagtttagctttatacgacatcaaagaaaagaagaagatatctgaaaacttttat
tttgacttaaactcggaacaagtaaaaggaatgttgcgtccatatgtctcctctccagcc
atcagtaccctggctagatcagctatcttttcaatcacttatccttcccaagatgtattc
ctggttataaaactggagaaggtgttgcagcaaggagatatcggagaatgtgcagaacct
tatatgatatataaagaagcagacacagcaaaaaacaaggacaaattggaaaaattgaaa
agtcaagcagatcagttttgccagagactgggaaggtaccgcatgccctttgcctggaca
gcaattcatctgatgaacatagtgagcagtgctgggagcctggaacgagattccaccgaa
gtagagattggcccagcagagcgtaaaggctcgtggtcagagagaagaaactccagcatt
gttggaaggcgctcattagaacgtaccactagtggtgatgagtcatgtaacctgactgcc
tttcgacctgcaacacttacagtgacaaacttctttaaacaggaaggagatcgactgagt
gatgaagatctatataaatttcttgcggatatgaagagaccatcatctgtgttaagaaga
ctgcgaccaattactgctcagctgaagatagatatatctcctgccccagaaaacccaaat
tactgcctaactccagaattgctacaagtgaaaccttatccggacagcagggtgcggcca
acaagagaaatattggagtttccagcaagagatgtgtatgtcccagatactacctacaga
aatcttctctatgtttatcctcaaagccttaattttgcaaatcgtcaaggctcagcaaga
aatataaccgtaaaagttcagttcatgagtggggaagatccgaataatgccatggcagta
atttgtggcaagtcaagttccccggaattttcgaaagaagcatatacaactgtagtatat
cacaacagatcacctgatttccatgaagagataaagatcaagcttccagctacacttacc
gatcatcaccacttactcttcacattttaccatgtcagctgtcaacaaaaacagaatacc
ccccttgaaactccagttggatatacatggataccaatgcttcagaatggccgcttgaag
acaggacagttttgcttgcctgtttccttagaaaagccaccacaggcatattctgtgctt
tctccagaggtccctcttcctggaatgaaatgggtggataatcacaaaggagttttcaat
gtcgaggttgttgctgtttccactgttcacacacaggtaagtacatttaaagcaaattac
cctgaatatgagctgaaaagtagcatatcagctctaagctctgctcagttggagcctgta
gtacaatttcttcacctcctgcttgataaattgattcttttggtcgtacggcctcctatc
atcgctgggcaaattgttaacctaggtcaggcatcatttgaggctatcgcttccatcaca
aacagactctacaaaaaccttgaaggaaatcacgatcagcatggcagaaataatcttctt
gcctcctacattcattatgtgttccggctgccaaacactgatcccaattcaccttcgcca
ggtcctggtggattgggaggatcaatgcactatgccacaatggcacggtcagtaaacaga
ccagcaagtcttaacttaaaccgatccaggagtcttagcaacagcaatcctgatatatct
gggaccccaacttcacctgatgatgaagtgcgatcaatcattggtagtaagggtttggat
cgctcaaattcctgggtaaacactggtggtcccaaaggtgcccagtggggaactaaccct
agtccaagtgctgaaacagtgcaggcaatggatcgatgtaatcgtatgtcttcgcacact
gagacgtcgagtttcttacaaactttaactggacgattaccaaccaaaaagcttttccat
gaagagttggctctgcagtgggtggtttgcagtggaacagtgcgtgaagctgctcttcag
caagcctggttcttttttgagctgatggtgaaaagcatggtacagcatctgtattttgct
gataaacttgattgtccaaggaagcaccggtttcctgaaagattcatggatgatatagct
gccttaatcagcacaatggctaatgacattgtcactcggtttcagaaggacacagaaatg
gtggaaaggcttaatgtcagtcttgcatttttcctcaatgatctgttgtctgtcatggat
agaggttttgtcttcgttcttattaaggcttatttcaaacaggtctcatcaaaactgtat
ctacagccaaatccaagcatattggtctcactgaggctggatttcttacgtataatttgc
agccatgaacactatgtcacattaaatctgccctgcagcttgctcactccaccttcatct
ccttctccttctgtttcatcagcaacttcccaaagctctgcattttctacaaatgtcctg
gatcaaaagatagcaaatatgtttgagttgtctgtgccatttcgtcagcagcattacttg
gcaggcctggtgctgactgagctggcagtcattttggatccagatgcagagggattgttt
ggattgcataagaaggtcattaatatggtacacaatttactatctactcatgactctgat
ccccggtatgctgatgcagaggtaaaggcccgagtggccacgctgtacctccctttgatt
ggcattgtcatggaaactgttccccagctttatgattttacagagagtcacaatcagcga
ggaagaccgaattgtacaacagctgatgaccatgatggcgatggtggaagtatgatcagt
cagtcagttgccatggctatagcaggaacatcagttccacaactcacaagaccaaacagc
tttctgctaacatcaacagcttcacggcagcatactacgttttcagcagaatctagccgg
agtctgttaatctgccttttgtgggttctaaagaatgcagatgagactgttctgcagaaa
tggtttactgacctctccatccttcagctaaatcgtttgcttgacctcttgtacctgtgt
gtttcctgcttcgaatacaagggtaagaaaacttttgaacggatgaacagcttgactttt
aagaaatccaaagatatgagagcgaagctagaagaagcaattctcggcagtattggcgcc
agacaagagatggtcagaagaagtagaggtcagcttgagagaagtccgtctggaagtgca
tttggcagccaagaaaacctacgctggaggaaagaaatgactcactggcggcagaacact
gataaaacagacaaatcaagggcagaacttgaacatgaagcacttatagatggaaacttg
gcaacagaagcaaatttaatcatactagatactttggaaatcattgttcagactatttca
ctgactgaatccaaggagagcattctgggaggtgtgcttaagactcttttacacagcatg
gcatgcaatcagagttctctctatttgcagcactgttttgccacacaaagagcccttgtt
tcaaagttcccagagcttttgttcgaggaagaaactgagcagtgtgcagacctgtgctta
agattacttcggcactgcagcagcagcatcagtaacataagatcacatgctggtgcttct
ctgtacctgcttatgagacagaactttgaaattggaaataatttcgcaagggttaaaatg
caggttaccatgtccttgtcatctttggtagggagatctcagaatttcaatgaagaattt
ttaagaaggtcactaaagactattttaacatatgctgaagaagatctagaattacgggag
acaactttccctgagcaggtccaggatcttgtgtttaatctccacatgattctctctgat
accgtgaaaatgaaagaacatcaagaagaccccgagatgcttattgacctgatgtacaga
attgcaaaaggttatcagacgtcacctgacctgcgcttaacctggttgcagaatatggca
ggaaaacactcagaaaggatcaatcacgcggagtcggctcagtgcctagttcactcagca
gctcttgtggctgaatatttaagtatgctagaggatcgcaagtaccttcctgtaggctgt
gttacctttcagaatatttcatctaatgtgttggaagagtctgcagtgtcagatgatgtg
gtatccccagatgaagaaggcatttgctcaggaaaatattttacagaggctggtttggtg
ggacttctagagcaagcagctgcctccttctcaatggctggtatgtacgaagcagttaat
gaagtctacaaagtgcttatacccatacatgaggccaacagagacgctaagaagctcgcc
acaattcatggaaaactccaggaagcatttagtaaagtagtccatcagagtactggctgg
gagagaatgtttgggacctactttcgggttggtttctatgggacaaagtttggagactta
gatgagcaagagtttgtgtataaagaaccagcaattacaaaactagcagaaatttcccat
cggctagagggcttttatggagaacgctttggagaagatgttcttgaagttattaaagat
tccaatccagttgataaatgtaaattagatcctaataaggccttcattcagataacctat
gtagaaccttattttgacacctatgaaatgaaggacaggattacatactttgacaaaaat
tataacctgcgacgattcatgtattgcaccccattcacactggacgggagagcccatggt
gaacttcatgaacagttcaagagaaagaccatcctaactacctcacacgcattcccgtat
attaaaaccagaataaacgtcatccataaggaggagatcattttaactcctatagaagtc
gccatagaggacatgcagaaaaagactcaggagctggcatttgcaactcaccaggatcca
gctgacccaaaaatgcttcaaatggtactacagggttcagtgggcacaacagtgaatcag
ggcccgctggaagttgcacaggtgttcctctcagaaatcccaaatgacccaaaactgttt
cggcatcacaataagctacgactttgtttcaaagactttacaaaaaggtgtgaagatgca
ctacggaaaaacaagagcctaatcggaccagaccaaaaggaataccagcgggaactggag
aggaactaccatcgtctgaaagaatcccttcaacctcttatcaatagaaagattcctcag
ttatacaagactgttttgccagttacctgccacagggattctttcagcagaatgagtctc
cggaaaatggacctctga

DBGET integrated database retrieval system