KEGG   Xenopus laevis (African clawed frog): 443911
Entry
443911            CDS       T01010                                 

Gene name
prdx1.S, msp23, nkefa, pag, paga, pagb, prdx1, prx-1, prx1, prxi, prxi-1, tdpx2
Definition
(RefSeq) peroxiredoxin 1 S homeolog
  KO
K13279  peroxiredoxin 1 [EC:1.11.1.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    443911 (prdx1.S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xla04147]
    443911 (prdx1.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     443911 (prdx1.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   443911 (prdx1.S)
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin MMU163
Other DBs
NCBI-GeneID: 443911
NCBI-ProteinID: NP_001085485
Xenbase: XB-GENE-865449
UniProt: Q6GQB3
Position
4S
AA seq 199 aa
MSVGNAKIGQPAPDFTAQAVMPDGQFKNLKISDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRVEEFKKINCEVIGASGDSHYCHLAWINQPRKEGGLGQMKIPLVADVQHTIAKDYGVFK
EDDGVSFRGLFIIDEKGILRQITINDLPVGRSVDETLRLVQAFQFTDKYGEVCPAGWQPG
SDTIKPDVQKSKEYFSKQK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtctgtcggaaatgcaaaaattggacagcctgcaccagacttcacagctcaggcagtg
atgccagatggacaattcaaaaatcttaaaatttcagactacaaaggaaagtatgttgta
ttcttcttttaccctctggatttcacatttgtgtgccccactgagatcatagcttttagt
gaccgggttgaggaattcaagaagattaactgtgaggttattggtgcatcaggggactct
cattactgtcatttagcctggattaaccaaccccgcaaggaaggtggtttgggccaaatg
aaaataccacttgtggcagatgttcagcatactatcgctaaggactatggtgttttcaaa
gaggatgatggagtttcatttagaggtctctttattatcgatgagaaaggcatactgaga
cagataacaattaatgacttacctgttgggcgctctgttgatgagactctgagacttgta
caggctttccagttcacagacaaatatggagaagtctgccctgcaggatggcagccagga
agtgacaccatcaagccagatgtccaaaagagcaaagagtacttcagcaagcagaaataa

DBGET integrated database retrieval system