KEGG   Xenopus laevis (African clawed frog): 444315Help
Entry
444315            CDS       T01010                                 

Gene name
dhx8.S, ddx8, dhx8, hrh1, prp22, prpf22
Definition
(RefSeq) DEAH-box helicase 8 S homeolog
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:xla00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    444315 (dhx8.S)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:xla03041]
    444315 (dhx8.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     444315 (dhx8.S)
Spliceosome [BR:xla03041]
 Complex C
  Other components
   Step II factors
    444315 (dhx8.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S1 DEAD AAA_22 T2SSE AAA_19 DUF4770 Transformer Flavi_DEAD AAA_16 Spem1 AAA_30 PhoH Presenilin Sigma54_activ_2 SAPS ABC_tran AAA_7
Motif
Other DBs
NCBI-GeneID: 444315
NCBI-ProteinID: NP_001085888
Xenbase: XB-GENE-6087203
UniProt: Q6GNM7
Position
9_10S
AA seq 798 aa AA seqDB search
MDEAAMDELQKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKSTSFEIFKSALEKN
GAEFTDSLISNLLRLIQTMRPPAKPSTSKETLIKPNGEKEKLKELFPALCRADNPTVRTM
LDPEDVKVAADALQELEALMPKEEKSSKHKDKKRRSRSRSRERGSKHRRRSRSRSRSRKK
AKDRYRSRSRSPVKEHRYSEHHSDKNTTGWKEKHVDRPPPEEPAIGDIYNGKVTSIMQFG
CFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKIKVLSFTGCKTSLSMKDVN
QDTGEDLNPNRRRNLIGDGNEEASMRNPDRPTHLSLVNAPEVEDDTLERKRLTKISDPEK
WEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDM
SPIKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAEMDSIPMGLNKHWVDPLPDVDGR
QIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVH
DNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVSEEYGCCLG
QEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFG
LLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDA
SLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSE
MQTRIFDPAPPGSRKRPP
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagctgcaatggatgaactacagaagcttgaatatctatccctggtctctaaa
gtctgcacagagctggataatcatttgggtatcaatgacaaagatctagctgaatttgtg
atcagcttagctgagaaatctacttcgtttgaaatatttaaatctgctcttgagaaaaat
ggtgcagaattcacagattcccttataagcaatttgctgcgtctgattcagacaatgaga
cctccagcaaaaccttctacaagcaaagaaactctgatcaagccaaatggtgaaaaagaa
aagctgaaagaattatttccagcactttgcagagcagataatccaactgtccggaccatg
ctagatcctgaggatgtgaaagtggctgcagatgcactgcaagaacttgaagcactaatg
ccgaaggaggagaaaagtagcaagcacaaagataaaaaaaggaggagccgcagtcgaagc
cgggagagaggtagtaaacatagacgtagatctcgctctagatcccgaagccgcaaaaaa
gcaaaagaccgatatagatcacgaagccgaagccccgttaaggagcaccgttacagtgaa
catcattctgataaaaataccacgggttggaaagagaagcatgttgatagaccaccaccc
gaagagccagcaattggggacatatacaatggcaaagtgacaagcatcatgcagtttggg
tgctttgttcagctggaaggcttaaggaaacgttgggaaggattggttcacatatcggaa
ctgagaagggaaggacgtgttgcaaatgtagcggacgtagtaagcaaaggacaaagagta
aaaattaaggtgctttccttcactggatgtaaaaccagcctcagcatgaaggatgttaat
caagacactggtgaagacctgaatcccaacagacgcagaaatctcataggtgacggtaac
gaagaagcgtccatgaggaacccagaccgaccaacccatctttctttagtaaatgcgcca
gaagttgaagatgataccttagaaagaaaacgccttacaaaaatctcagatcctgaaaag
tgggagatcaaacagatgattgcagctaatgttctctcaaaagaagaattccctgatttt
gatgaggagactggaattcttcctaaagtggatgatgaggaagatgaggaccttgagatt
gagctggttgaagaagaacctccgtttcttagaggacacacaaaacagagtatggacatg
agtcctataaaaatagtaaagaatccagatggctctctttctcaagctgctatgatgcag
agtgctttagcaaaggagagacgagaagtgaagcaagctcagcgggaagcagagatggat
tctatacctatgggattgaacaaacattgggtggatcctttgcctgacgttgatggaaga
caaattgctgctaatatgaggggaattggaatgatgccaaatgatattccggaatggaag
aagcatgcttttggtggcaacaaagcatcctatggaaaaaagacccagatgtcaattttg
gaacagagggaaagtctccccatttacaagctgaaggagcagcttgtgcaggctgtgcat
gacaaccagatcctcattgttattggggaaactggctcaggaaaaacaacccaaattact
cagtatttggcagaagctggttacacgaccagagggaaaataggctgcacccagcccaga
agagtcgctgcaatgtctgttgctaagagagtgtctgaagaatatggctgttgtttagga
caagaggttggatacactattcgatttgaggattgtacaagccccgagacagtcataaag
tacatgactgacggtatgctcctgagagaatgccttatagaccctgacctgacacagtat
gccataatcatgttggatgaggcccacgagagaacaattcatacagatgtgctttttggt
ctccttaagaagactgtacagaagcgtcaagatatgaagctcattgtgacctccgcaaca
ctggatgcagtcaaattctcccagtatttctatgaggctccaatttttaccattcctggt
cggacataccctgttgagattctttatacaaaggagccagagacagactacctggatgcc
agtctcattacagtcatgcagatacatttgacagaaccaccaggagatattttagtattc
cttacaggacaggaggaaattgatactgcctgtgaaattctctatgaaagaatgaagtct
cttggacctgatgtgccagagctgattattctacctgtttattctgcattgcccagtgaa
atgcagacaaggatatttgacccagcacctcctgggagcagaaagagacctccctaa

DBGET integrated database retrieval system