KEGG   Xenopus laevis (African clawed frog): 444623
Entry
444623            CDS       T01010                                 

Gene name
rdh5.L, rdh5
Definition
(RefSeq) retinol dehydrogenase 5 (11-cis/9-cis) L homeolog
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    444623 (rdh5.L)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     444623 (rdh5.L)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 444623
NCBI-ProteinID: NP_001086194
Xenbase: XB-GENE-1011662
UniProt: Q6GLY2
Position
2L
AA seq 319 aa
MWCYVLLFAMAWIIGWLLRDRQKISRFSNKHVFITGCDTGFGNLLAKRLSRKGFQVLAGC
LTQVGAEDLQKVCPTGLKCTLLDVTNQDSINKAVEWVKSEVGDRGLYGLVNNAGIANPIG
PTEWMTIQDYKKVMEVNAFGTIAVSLSFLSLIKKAQGRIVNMASILGRISANGGGYCVSK
YAVEAFSDSLRRDMQHFGVRVCIIEPGFFKTAVTNLDSIERSLQLLWDQMPPETRMTYGD
KYLQQYLKMQRLIMNFICDPDISKVPKCIEHALQSRYPRTRYSPGWDAKLVWLPASYMPA
FITDAVLAFVLPKPAHRVH
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgttacgtgcttctctttgccatggcctggatcattggatggctgctaagggac
aggcagaagatttcaagattctcaaacaaacatgtctttatcactggctgtgacactggc
tttggcaatttgctggccaagagactaagccgaaagggtttccaagtcctggctgggtgc
ctcactcaagtgggagcagaagacctgcagaaagtttgtcctaccggcctgaagtgcact
ctactggatgttaccaaccaggatagtataaacaaggcagttgagtgggttaagtcagag
gtgggagacagaggcctctatgggttagttaacaatgctgggatcgctaatcccattggg
cccactgaatggatgaccatacaggactataagaaagttatggaagtcaatgcatttgga
accattgctgtctctctgagctttttgtcactgataaagaaggcacaagggcgtattgtc
aacatggccagcatccttggaaggatttcagctaatggaggcgggtactgcgtgtccaag
tatgcggtagaggccttctctgacagtttacgacgggacatgcaacactttggggtaaga
gtgtgcatcatagagcctggattcttcaagacagctgtgaccaacctggattctattgag
cgctccttgcaactactctgggatcagatgccgccagagacaaggatgacctatggggac
aagtacctccaacaatacctgaaaatgcaaagactcatcatgaacttcatctgtgatccg
gacatctccaaagtgcccaagtgtatagaacatgccttgcaatcccgatacccacgcaca
agatacagtccaggttgggatgccaagctggtgtggctaccagcctcttacatgccagcc
ttcattacagacgctgtactggcttttgtgcttcccaaacctgcacacagagtccattag

DBGET integrated database retrieval system