KEGG   Xenopus laevis (African clawed frog): 444738Help
Entry
444738            CDS       T01010                                 

Gene name
abhd6.L, abhd6, abhd6-a, abhd6-b
Definition
(RefSeq) abhydrolase domain containing 6 L homeolog
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
KEGG Orthology (KO) [BR:xla00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xla01002]
    444738 (abhd6.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     444738 (abhd6.L)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S33
   444738 (abhd6.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 Lipase Abhydrolase_5 Abhydrolase_3 Esterase
Motif
Other DBs
NCBI-GeneID: 444738
NCBI-ProteinID: NP_001086309
Xenbase: XB-GENE-6078225
UniProt: Q6GLL2
Position
Un
AA seq 337 aa AA seqDB search
MDLDVLNMFLVAGGTLLVPILAFVTSFLLWPAALIKIYYWYWRRALGMQVKFSSYGNYKF
CYTSRGKPGNKASVLMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSALDDYS
ICGQVKRIHQFVESIGLNKRTFHLVGTSMGGNVAGVYAAQHPTDISSLTLICPAGLMYPT
ESKFLKHLKGLEKSGDDQRILLIPSTAGEMEDMLRLCSFVRFKIPQQVLQGLVDVRIPHN
EFYRQLFMALVNEKSRHSLQENMNKIVAPTQIIWGKQDQVLDVSGAEVLAGSIRGCQVEI
LENCGHSVVMERPRKSAKLMTDFLSSLQSTENNKKHE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatttagatgtactaaacatgttcctggtggcgggagggaccctccttgtccctatt
ttggctttcgtgacctccttcctcttgtggccggctgcgctcatcaagatttattattgg
tactggcgccgggccctggggatgcaggttaaattttccagctatgggaactataaattc
tgctacacgtcccgcgggaagccgggaaacaaggcgtcagtcctgatgctccacggattc
tctgcccataaggacatgtggctgtcggtggtgaagttccttcccaagaaccttcacctg
gtgtgtgtggatatgccaggccacgagggcaccacccgttctgcattagacgactactcc
atctgtgggcaagtgaagaggatacaccagtttgtggaaagcatcggactgaacaagagg
actttccatttggtcggcacctcgatgggggggaatgtggcaggtgtttatgccgcccag
cacccaactgatatcagcagcctcaccctcatctgtcctgcaggtttgatgtatccaacc
gagagtaagttcctaaaacacctgaagggcctggaaaaatctggcgacgaccagaggatc
ctgctcatcccgtccacagccggagaaatggaggacatgctgagactctgctcttttgtt
cgcttcaagatcccccagcaggtcctgcaggggctcgttgacgtgcgcattccccataat
gaattttacagacaattgtttatggctcttgtcaatgagaagtcgagacacagtttgcag
gaaaacatgaacaaaattgtggctcccactcagataatctggggcaaacaagaccaggtt
ctggatgtatctggggctgaggttttggccggttctatccgcgggtgccaagtagagatt
ctggagaactgcggccactcagtagtgatggaaaggcccaggaaaagcgccaaactcatg
acggacttcttgtcttcacttcagagcacagagaacaacaagaaacacgaatag

DBGET integrated database retrieval system